KEGG   Staphylococcus saprophyticus: SSP1072Help
Entry
SSP1072           CDS       T00269                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00020  Citrate cycle (TCA cycle)
ssp00480  Glutathione metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
ssp01210  2-Oxocarboxylic acid metabolism
ssp01230  Biosynthesis of amino acids
Module
ssp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSP1072
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SSP1072
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SSP1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAE18217
UniProt: Q49YC4
LinkDB All DBs
Position
1115939..1117204
Genome map
AA seq 421 aa AA seqDB search
MAGEKVAKTNEGLTVPNNPIIPFIIGDGIGPDIWKAASRVIDAAVEQAYNGEKKIEWKEV
LAGQKAYDETGEWLPQATLDTIEEYLIAIKGPLTTPIGGGIRSLNVALRQELDLFTCLRP
VRWFQGVPSPVKRPEDTDMVIFRENTEDIYAGIEFKEGTPEVKKLIDFLQDEMGAKNIRF
PETSGIGVKPVSKEGTERLVRAAIQYAVDNNRKSLTLVHKGNIMKFTEGAFKQWGYDVAH
NEFGDKVFTWQQYDEIVEKEGKDKANAAQEQAEKDGKIIVKDSIADIFLQQILTRPSDHD
VVATMNLNGDYVSDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYADLNKVNPSS
EILSAVLMLEHLGWQEAADKITASIEKTIASKVVTYDFARLMDGAKEVSTSDFADELIKN
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgaaaaagtagcaaaaacaaatgaaggtttaacagtaccaaataatccaatc
attccatttattattggtgatggtattggaccagatatttggaaagcagcaagcagagta
atcgatgctgcagtagagcaagcttataatggtgaaaagaaaattgaatggaaagaagta
ttggcaggccaaaaagcctatgatgaaacaggtgaatggttaccacaagcaacgcttgat
acaattgaagaatatttaattgctatcaaagggcctttaactacaccaattggtggcggt
attcgttcacttaacgttgcgttacgacaagaattagatttattcacatgcttacgtcca
gtacgttggttccaaggtgttccatcaccagttaaacgtccagaagatacagacatggtt
atcttccgtgaaaacactgaagacatttatgctggtattgaatttaaagaaggcacacca
gaagttaaaaaactaatcgactttttacaagatgaaatgggcgctaaaaatattagattc
cctgaaacatcaggtattggtgttaaaccagtatcaaaagaaggtacagagcgtttagtt
cgtgcagcgattcaatacgcggtagacaataaccgtaaatcattaacattagtccacaaa
ggtaatatcatgaaatttactgagggcgcatttaaacaatggggttatgatgtagcgcat
aacgaatttggtgacaaagtatttacatggcaacaatatgatgaaatcgttgaaaaagaa
ggtaaagacaaagcgaatgcggctcaagaacaagctgaaaaagatggtaaaattatagtg
aaggattcaattgctgatatcttcctacaacaaatcttaacacgtccgtcagatcacgat
gttgttgctactatgaatttaaatggtgactatgtatcagatgcattagcagcacaagtt
ggtggtatcggtatagctccaggagcaaatataaattatgaaactggacatgctattttt
gaagcaacacatggtactgcgcctaaatatgctgacttaaataaagtgaatccatcatca
gaaattttaagtgccgtattaatgttagaacatttaggatggcaagaagctgcagataaa
attactgcatctatcgaaaaaacaatcgcgtctaaagtagttacttatgactttgctcgt
ttaatggatggtgcgaaggaagtttctacatctgactttgctgatgaattaattaaaaat
ctataa

DBGET integrated database retrieval system