KEGG   Staphylococcus saprophyticus: SSP1851Help
Entry
SSP1851           CDS       T00269                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssp  Staphylococcus saprophyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos 5_nucleotid_C
Motif
Other DBs
NCBI-ProteinID: BAE18996
UniProt: Q49W63
LinkDB All DBs
Position
complement(1930880..1932199)
Genome map
AA seq 439 aa AA seqDB search
MKLTIYHTNDIHSHLHEYARITEYLAQERPKLKHPSLYLDIGDHVDLSAPVTEATMGIKN
VELLNDAHCDLATIGNNEGMTISHDALNTLYDNAKFDVTCANVFDERGQLPNNISSSFIK
VIDGVRILFVAATAPFTPFYRALDWVVTNPLEAIKDEISANEGAYDLLIIMSHVGVFFDE
KLCQEIPEIDLILGSHTHHYFENGEFNHDVLMAAAGKYGYFLGEVTLEIEDNVVVHKEAT
IHPIEKLPEVETHFEAEGKALLSDAVIDYPIQLPRRTNMISQTSYMLAESLFEFTNADCT
IINAGLIVQGIDGNQITEYDIHQMLPHPINAVRIKLSGQELKQVIIKSQKQEYLNEHAQG
LGFRGDIFGGYILYNLGFIESESRYFINGEEIDNDGTYILGTVDMYTFGRYFPMLKDQAI
DYLMPEFLRDIFKEKLLEY
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaacaatttatcatacgaatgatatacacagtcatctacatgaatacgcacgt
atcactgagtatttagctcaagagagacctaaattgaagcatccctcgctctacttagat
ataggtgatcacgttgatttgtcagcgcctgtgactgaggcaacgatgggtatcaaaaat
gttgaattattaaatgatgcacattgtgatttggctacgattggtaataacgaaggtatg
acgatatctcatgatgcattaaacacattatacgataatgcaaaatttgatgtgacttgt
gccaatgtttttgatgaacgcggtcaattaccaaataatatctcttcatcatttattaag
gtaatagatggtgtgcgtatattatttgtggctgctacagctccatttacgccgttttat
agagcgctagactgggttgtgacgaatccattagaagcaattaaagacgagataagtgct
aatgaaggtgcttatgatttattaattattatgagtcatgtaggggtcttttttgacgaa
aagttatgtcaggaaatacctgaaattgatttaattttaggaagtcatacgcatcattat
ttcgaaaatggtgaatttaatcatgacgtgcttatggcagctgcaggtaaatatggttat
ttcttaggtgaggttactttagagattgaagataatgttgtagtgcataaagaagcaacg
attcaccctatagaaaagctgcctgaagtagaaacacattttgaagcggaaggcaaggca
ctccttagtgacgctgtcatagattatcctatccaattacctagaagaacgaacatgatt
tcacaaacatcttatatgctagcagagagtttgtttgaatttacgaatgcagattgtacg
attattaatgctggtttaattgtacaaggaattgatggtaatcaaattacagaatatgat
attcatcaaatgttaccgcatccaattaacgcagtgcgtattaaattaagtggtcaagaa
ttaaagcaagtaattattaaaagtcaaaagcaagaatatttgaatgaacatgcgcaaggt
ttgggttttagaggtgatatttttggcggttatattttatataaccttggatttatcgaa
tcggaatcacgttattttatcaatggtgaagaaatagataatgatggcacgtatatctta
ggaacagttgatatgtatacatttggtagatatttcccaatgttaaaagaccaagccata
gattacttaatgccagagtttttacgagatattttcaaggaaaaattgttagaatattaa

DBGET integrated database retrieval system