KEGG   Staphylococcus saprophyticus: SSP2334Help
Entry
SSP2334           CDS       T00269                                 

Definition
(GenBank) putative alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ssp  Staphylococcus saprophyticus
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SSP2334
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SSP2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA DAO Thi4 FAD_oxidored FAD_binding_2 NAD_binding_9 AlaDh_PNT_C K_oxygenase NAD_binding_8 FAD_binding_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: BAE19479
UniProt: Q49UT7
LinkDB All DBs
Position
2415525..2417048
Genome map
AA seq 507 aa AA seqDB search
MLNNQLKSQLQQLLQLMEGDVVLKASLGSDDKSKELKELLDEVSAASDYITIEASDLKRT
PSFSVDKPNETSGITFAGLPMGHEFNSLVLALLQVSGRPPKEEQAIIDQIKAIDRPLHFE
TYISLTCQKCPDVVQALNLMSLLNPNISHTMIDGSIFREESENIMAVPAIFLDGEEFGNG
RMTIQDILANLGSQADPAEFNDKAPYDVLIVGGGPASGSAAVYTARKGLRTGIVADRIGG
QVNDTATIENFVTVKETDGPKFSSALEDHIKQYDVDVMTGIRASDIEKTDDGIVVTLDNG
AQLTSKTVIISTGARWRKLEVPGEEALINKGVAFCPHCDGPLFENKNVAVIGGGNSGVEA
AIDLAGIVEHVTLLERNANLKADNVLQERLNSLPNVTVIKNAQTTEVLGDDAVTGIKYQD
KAQGEEHTLDLEGIFVQIGLLPNTEWLNNYVELNDAKEIKVDRTNATSIPGIFAAGDVTD
DRNKQIIISMGAGANAALNAFDYIIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctaaataatcagcttaaatcacaattgcaacaattacttcaattgatggaaggcgac
gtagttctaaaagcgagccttggttcagatgataaatctaaagaactgaaagaactttta
gatgaagtatctgccgcgtccgattacattactatagaagcatctgacttgaaacgtaca
ccaagcttttcagtagataaacctaatgaaacatcaggcattacttttgctggtttacca
atgggtcatgaatttaattctctagttcttgctttgttacaagtaagtggtcgtccacca
aaagaagaacaagccattatagatcaaattaaagcaatcgatcgtccactacattttgaa
acgtatattagcttaacgtgtcaaaaatgtcccgacgtagttcaagcattaaatttgatg
agtttattaaatccaaatatttctcatacaatgatagatggctctattttcagagaagaa
tctgaaaatattatggcagtacccgctattttcttagatggcgaagaatttggaaatgga
cgcatgacgatccaagatattttagcaaatcttggtagccaagcagatccagctgaattt
aatgataaagcaccatacgacgtattaattgtcggtggtggtcctgcaagtggtagtgct
gcagtttacactgcacgtaaaggtttacgtactggtatcgtcgcagaccgtattggtggt
caagtcaacgatacagctaccattgagaactttgtcactgttaaagaaacagatgggcct
aaattctcatctgcattagaagatcatatcaagcaatatgatgtcgatgtcatgacaggt
attcgtgccagtgatattgaaaaaacggatgacggtattgtcgtaacattagataatggt
gctcaattgacgagtaagacggttattatttcaacaggtgcgcgttggcgtaaactagaa
gtcccaggtgaagaagcattaatcaataaaggtgttgcattctgtccacactgtgacggc
ccgttatttgaaaataaaaatgtcgctgttataggtggcggaaattcaggcgtcgaagct
gcaatcgacttagctggcatcgttgaacatgttacattacttgaacgtaacgctaacctt
aaagcagacaatgttttacaggaacgtttaaacagcttacctaatgtaacagttattaaa
aatgctcaaacaaccgaagtacttggagacgatgcagtgactggtattaaatatcaggat
aaggcacaaggtgaggaacatactctagatttagaaggtatctttgtacaaattggatta
ctacctaatacagagtggttaaacaattatgtagaactaaatgatgccaaagaaattaaa
gtagaccgcacgaatgcgacaagtatcccaggtatatttgcggcaggcgatgtcactgat
gatcgcaataaacaaattattatttcaatgggcgcaggtgctaatgcagcattaaatgct
tttgattatattatcagacattag

DBGET integrated database retrieval system