KEGG   Streptococcus suis D9 (serotype 7): SSUD9_1530Help
Entry
SSUD9_1530        CDS       T02022                                 

Definition
(GenBank) manganese-dependent superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Brite
Enzymes [BR:ssq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SSUD9_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N TGF_beta_GS
Motif
Other DBs
NCBI-ProteinID: AER17714
LinkDB All DBs
Position
complement(1522044..1522649)
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLVALLSDV
EQIPADIRQALINNGGGHLNHALFWELLSPEKTEISAELAADIDATFGSFDAFKEAFTAA
ATTRFGSGWAFLVVNKEGKLEVISTANQDTPIMQGLKPILALDVWEHAYYLNYRNVRPNY
IKAFFEVINWDKVNELYKAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttaccagaccttccatacgcatacgatgccttggaaccacatattgat
gcagaaacaatgacccttcaccacgataagcaccatgcgacttatgttgcaaatgctaat
gcagcacttgaaaaacatcctgaaattggcgaagacttggtagctcttttgtcagatgtg
gagcaaattccagctgacatccgccaagctttgataaacaacggtggtggtcatttgaac
catgctcttttctgggaattgctttcacctgaaaaaacagaaatttcagcagaattggca
gcagatattgatgcaacctttggttcatttgatgctttcaaagaagccttcactgcagca
gcaacaactcgtttcggttcaggttgggctttcttggttgttaataaagaaggtaagttg
gaagttatctcaactgctaaccaagacacaccaatcatgcaaggtttgaaaccaatcttg
gcattggatgtttgggaacatgcttattacctcaactaccgcaatgtgcgtccaaactac
atcaaagccttctttgaagtaatcaactgggacaaggttaacgaactttataaagcagct
aaataa

DBGET integrated database retrieval system