KEGG   Streptococcus salivarius CCHSS3: SALIVB_0202Help
Entry
SALIVB_0202       CDS       T01580                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin (heat shock protein 33 homolog) (HSP33)
  KO
K04083  molecular chaperone Hsp33
Organism
ssr  Streptococcus salivarius CCHSS3
Brite
KEGG Orthology (KO) [BR:ssr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssr03110]
    SALIVB_0202 (hslO)
Chaperones and folding catalysts [BR:ssr03110]
 Heat shock proteins
  HSP33
   SALIVB_0202 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: CCB92519
UniProt: F8LGP9
LinkDB All DBs
Position
184001..184867
Genome map
AA seq 288 aa AA seqDB search
MDKLIKTISESGSFRAYVLDSTETVRTAQEKHNTLSSSTVALGRTLIANQILAANQKGES
KITVKVIGNSSFGHIISVADTKGHVKGYIQNPGVDIKKTATGEVLVGPFMGQGQFVSIID
YGTGNPYTSSTPLISGEIGEDFAYYLTESEQTPSAVGLNVLLDEEDKVKVAGGFMLQVLP
GASEEEIARYEKRIQEMPAISTLLESDDHIEALLNAIYGDEPFKRLSEEELSFDCDCSRE
RFENALLTLGKDELQAIKDEDHGAEIICQFCQNKYEFSEADLEELIND
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggataaattaattaaaacaatttcagaatcaggttctttccgtgcttatgttcttgat
agcacggaaactgttagaaccgcacaagaaaaacacaatactttatcatcatcgacagtt
gctttggggcgtacccttattgctaaccaaatcttggctgctaaccaaaaaggtgaaagc
aaaattacggttaaggttatcggaaatagctcttttgggcatatcatctcagtagctgat
accaaaggacatgttaagggctacatccaaaatccaggcgtggacatcaagaaaacagcg
actggtgaagttttggtaggacctttcatggggcaagggcagtttgtctcaatcatcgat
tatggaactggtaatccttacacgtcatcaacaccacttatttctggtgaaattggtgaa
gattttgcctactatttgacggaatctgagcaaacgccatctgctgttggtcttaatgta
cttcttgacgaagaggacaaggttaaggttgctggtggtttcatgcttcaggtcttgcca
ggggctagcgaggaagaaatcgctcgttacgaaaaacgcatccaagagatgccagccatt
tcaacgcttttggagtctgatgaccatatcgaagctctcttgaatgctatttatggggat
gagcctttcaaacgtttgtctgaagaggagcttagctttgactgtgattgctcacgtgaa
cgctttgaaaatgccctcttgacgcttggtaaggatgaacttcaagctattaaagatgaa
gatcatggtgctgaaatcatctgccaattctgccaaaacaagtatgaattttcagaagct
gacttggaggaactcatcaatgactaa

DBGET integrated database retrieval system