KEGG   Streptococcus salivarius CCHSS3: SALIVB_0469Help
Entry
SALIVB_0469       CDS       T01580                                 

Definition
(GenBank) hypothetical protein
  KO
K07706  two-component system, LytTR family, sensor histidine kinase AgrC [EC:2.7.13.3]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
ssr02020  Two-component system
ssr02024  Quorum sensing
Module
ssr_M00495  AgrC-AgrA (exoprotein synthesis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SALIVB_0469
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SALIVB_0469
Enzymes [BR:ssr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SALIVB_0469
Protein kinases [BR:ssr01001]
 Histidine kinases
  LytTR family [OT]
   SALIVB_0469
Two-component system [BR:ssr02022]
 LytTR family
  AgrC-AgrA [MD:M00495]
   SALIVB_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_5 HATPase_c BSMAP Glyco_hydro_30C HGWP
Motif
Other DBs
NCBI-ProteinID: CCB92775
UniProt: F8LHF5
LinkDB All DBs
Position
complement(446310..447341)
Genome map
AA seq 343 aa AA seqDB search
MLGFYVFPLLGVYVFNEASLSWYDILIELLVFPFHLLIVKSLKLDFNEIKEGFKRHYFRY
LLLLINISMLLYMLLVSTFVIYRDKLANADIWRGHINNFYIILFFVMLLYLNAISKEKLE
KEIIKQKDTQLYELSSYSHHVESLYEEIRGFRHDYINILTSLKLGIDNQDIDAVKTVYND
VLKDSAKQFYDSKFDIAKLSNIKNDAIKSILSAKLLEAQNRGISISVEVEEPISNFRIEL
LDFITVLSVLCDNAIEAAIETISSKMTVVFINNDDSLVLIVENSIKSEKVEVSRIFVRGH
SSKGEGRGIGLYNVNSILEKYPKSTITTRSANHLFSQTIRFCK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctaggattctacgtttttcctttactaggagtctacgttttcaatgaagcctcacta
agttggtacgatatcttaattgaattactggttttccctttccatttactcatagtaaaa
tctcttaaattagattttaacgaaataaaagagggtttcaagcgtcactatttcaggtat
ttattattactaattaatatctccatgcttctatatatgttgttagtttctacatttgtt
atttatagagataaattagctaatgcagacatctggagagggcatattaacaacttttat
attattctgttttttgtaatgctactctacctcaatgcaatctcaaaagaaaaactagag
aaggaaataattaagcaaaaggacacccaattatatgaactatctagttacagccatcac
gttgaatccctttatgaggaaattagaggtttccgtcatgactacattaatattttgaca
agtctaaaattagggattgataatcaagatattgacgctgttaaaactgtttacaatgat
gtccttaaagacagtgcaaaacaattctatgatagtaagtttgatatagctaaacttagc
aatattaagaatgatgctattaaaagtattctttccgctaaattactcgaggcacagaat
agagggatttcaatttctgtcgaggttgaagaacctattagcaattttaggatagaatta
ctagattttatcactgttctatctgtcctttgtgacaatgctatcgaagccgccattgaa
actattagttcgaaaatgactgtcgttttcataaataatgatgattcgttggtgcttatc
gtcgaaaatagtataaaatcagaaaaggtcgaggttagtcgcatttttgttagaggtcac
tctagtaaaggggagggtagaggtattggcttatataatgtaaatagtatattggaaaaa
taccctaaatctacgattaccactcgtagtgcaaatcacctcttttctcaaactatcaga
ttttgtaaataa

DBGET integrated database retrieval system