KEGG   Streptococcus salivarius CCHSS3: SALIVB_1752Help
Entry
SALIVB_1752       CDS       T01580                                 

Gene name
yfbQ
Definition
(GenBank) uncharacterized aminotransferase yfbQ
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
ssr00220  Arginine biosynthesis
ssr00250  Alanine, aspartate and glutamate metabolism
ssr00290  Valine, leucine and isoleucine biosynthesis
ssr01100  Metabolic pathways
ssr01110  Biosynthesis of secondary metabolites
ssr01130  Biosynthesis of antibiotics
ssr01210  2-Oxocarboxylic acid metabolism
ssr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SALIVB_1752 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    SALIVB_1752 (yfbQ)
   00220 Arginine biosynthesis
    SALIVB_1752 (yfbQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssr01007]
    SALIVB_1752 (yfbQ)
Enzymes [BR:ssr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SALIVB_1752 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     SALIVB_1752 (yfbQ)
Amino acid related enzymes [BR:ssr01007]
 Aminotransferase (transaminase)
  Class I
   SALIVB_1752 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CCB94012
UniProt: F8LKZ2
LinkDB All DBs
Position
complement(1838101..1839315)
Genome map
AA seq 404 aa AA seqDB search
MKTFDKSSKLEHVAYDIRGPVLDEANRMIAKGEKILRLNTGNPAEFGFTAPDEVIRDLIM
NVRNSEGYSDSKGIFSARKAIMQYCQLKGFPNVDIDDIYIGNGVSEMISMSMQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYVCDEKSNWYPDIDDIKSKITSNTKAIVVINPNNP
TGSLYPKDVLEQIVDIARQNDLIIFADEIYDRLVMDGKKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKKNVKGYIEGLNMLANMRLCANVLSQHVIQTSLGGYQSVDELL
IPGGRIYEQREFITNTVNAIPGLSAVKPDAGLYIFPKIDRNMYDIEDDEEFCLRLLKKEK
VLLVPGKGFNWNEPDHFRIVYLPRVEELADLGNKIERVLSYYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgataaatcatcaaagttggaacacgttgcctatgatattcgtggacca
gttttggatgaagccaaccgtatgattgctaaaggtgaaaagattcttcgtcttaatacg
ggaaatcctgcggaatttggctttacagcaccggatgaagtcattcgtgatttaattatg
aatgttcgtaacagtgaagggtattcagatagtaaggggattttctcagctcgtaaggcg
attatgcagtattgccagctaaagggattcccaaatgtagatattgatgatatttatatt
ggtaatggtgtttcagagatgatttccatgtctatgcaggccttgcttgatgatggagat
gaggtcttggtcccaatgcctgactatcctctttggacagcctgcgtcagtctagcaggt
ggtaatgctgtacactatgtctgtgatgaaaaatctaactggtatccagatattgatgat
atcaaatcaaagattacgtcaaatactaaggcaattgtagtcatcaatcctaataatcct
acaggttcactctatcctaaggatgtccttgaacagattgtggatattgctcgacaaaat
gatttgattatctttgcggatgagatttatgaccgcttggttatggatggtaaaaagcat
actgcgattgctagccttgcaccagatgtcttctgtgtgtctatgaatggtctttctaag
tctcaccgcatttgtggtttccgtgtaggttggatggttctctctggacctaaaaagaat
gtcaaaggttatattgaagggcttaatatgttggccaacatgcgtctttgtgctaatgtg
ctctctcagcacgttattcagacttcacttggtggttaccaatccgtggatgaactcttg
atccctggtgggcgtatctatgaacaacgtgagtttatcacgaataccgtaaacgctatt
ccagggctttcagctgttaagccagatgcaggtctttacatcttccctaagattgaccgt
aacatgtatgatattgaagatgatgaagaattctgtcttcgtctcttgaagaaggagaag
gttctcctagttccaggtaaaggctttaactggaatgaaccagatcacttccgtattgtc
taccttcctcgtgtggaagagttggctgatctcggtaacaaaatcgaacgagtcttgtca
tattacaagcgttaa

DBGET integrated database retrieval system