KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_0370Help
Entry
SSUSC84_0370      CDS       T00937                                 

Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Brite
KEGG Orthology (KO) [BR:sss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sss01001]
    SSUSC84_0370
Enzymes [BR:sss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SSUSC84_0370
Protein kinases [BR:sss01001]
 Serine/threonine kinases: Other
  Bacterial family
   SSUSC84_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH RIO1 Kinase-like Kdo FTA2
Motif
Other DBs
NCBI-ProteinID: CAZ51148
LinkDB All DBs
Position
409464..411458
Genome map
AA seq 664 aa AA seqDB search
MIQIGKIFAGRYRIVRQIGRGGMADVYLARDLILDGEEVAVKVLRTNYQTDQIAIQRFQR
EARAMAELDHPNIVRISDIGEEDGQQYLAMEYVNGLDLKRYIKENAPLSNDVAVRIMGQI
LLAMRMAHTRGIVHRDLKPQNVLLTSNGVAKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATIQSDIYAMGIILFEMLTGRIPYDGDSAVTIALQHFQKPLPSVREENANVP
QALENVVLKATAKKLNERYKSVAEMYADLASALSMDRQNEPRVELEGNKVDTKTLPKLSQ
ANVETKVPHTNSSAQVSATDKGSGKKEVAKSGNKPVSKPRPGIRTRYKVLIGAILLTVIA
AGLMFFNTPRTVTVPDVSGQTVEKATEMIEVAGLEVGNITEEATATVDEGLVIRTSPAAK
TTRRQGSKIDIVVATAALASIPDVVDKESDTARQELEALGFQVTIKEEYSEKVAQGLVIK
TDPGANSSAEKGAKITLYVSKGVAPQVVPNVVGKSQENATQILQTAGFSIGTITQEYSSS
VTAGQVISTDPVANTELAKGSIINLVISKGKELIMPDLTSGNYTYSQARSQLQALGVNAE
SIEKQEDRSYYSTTSDIVIGQYPAAGATIDGTVTLYVSVASTRTSSDSSAGSSTSTSTST
GSGQ
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcggtaagatctttgccggtcggtatcgaatcgttcggcaaattggtcga
ggcggtatggcagatgtttacctagcaagagatttgattttagatggagaagaggttgct
gttaaagttcttcggaccaactatcagacagatcaaattgctatccagcgttttcaacgt
gaagcgcgtgccatggcagaacttgaccatcccaatatcgttcgtatttcggacatcggt
gaagaagatggtcaacagtatctggctatggaatatgtcaatggcctcgatttaaaacgt
tatataaaagaaaatgcaccactttccaacgatgttgcggtgcgaattatgggacagatt
ctccttgctatgcgcatggcgcacacgagaggaattgtccatcgagatttgaaacctcag
aacgtccttttgacttccaatggagtcgctaaagtaacagactttggtattgcagttgcc
tttgctgaaacgagtttgacacaaaccaactccatgttgggttctgttcactatctttca
cctgagcaggcgcgtggttcgaaagcgaccattcaaagtgatatttatgcgatgggaatc
atcctttttgaaatgttgacgggtcgcattccctatgatggagacagtgctgtgacgatc
gctcttcagcatttccaaaaacctctcccatctgttagagaagagaatgccaacgtacct
caggccttagaaaatgttgtactaaaagcaacggcaaaaaaattaaacgagcgctataag
tcggttgcagaaatgtatgcagatttagcttcggctctatccatggatcgtcagaatgaa
cccagggttgaactagaagggaacaaggttgatacaaaaaccttgccgaaactctcccaa
gccaatgttgaaacgaaagtaccgcatacaaacagttctgctcaagtttctgcgacggat
aaggggtctggtaagaaagaagtggcgaagtcgggaaataagcctgtttcaaaaccaagg
ccaggcatacgtacacgctacaaagtcttgataggagctattttgttaacagtcatagcg
gctggactcatgtttttcaacactccacgaacagttacagtccctgatgtatctggtcaa
accgttgaaaaagctacagaaatgattgaagtggcaggattggaagttggaaatatcaca
gaagaagcgacagcgactgtagatgaaggcttggtaatacggacctctccggctgcaaag
acgaccagacgtcaagggagtaagattgatattgtagtagcaacggctgcgctggcatct
attccagatgtggtggataaggagtctgatactgcgcggcaggaattggaggcccttggt
ttccaagtgacaataaaagaagaatatagcgaaaaagttgcccaaggactcgttatcaaa
acagatccaggagcaaatagttctgctgagaagggtgcaaaaattaccctttacgtttcc
aaaggagtggcgccacaagttgttccaaacgttgttggaaaaagtcaggagaatgctact
caaattcttcagacagcaggcttcagcattggaaccattactcaggaatatagctcatct
gttactgcaggtcaggttatcagcacagatcccgttgccaatacagagttggcaaaaggt
tctatcatcaatctagttatttcaaaaggaaaagaattgattatgcctgatttaacatct
ggcaattacacctattcacaggcgcgtagtcaattacaagccttgggtgtcaatgcggaa
agtattgaaaaacaagaagatagaagctattattcaacgacaagtgacatcgtcattgga
caatatcctgctgctggagcaacaattgatggaacagttaccttgtatgtctctgttgca
tcaaccagaaccagtagcgattcttcagcaggaagttccacaagtacaagtacttcaaca
ggtagcggacaataa

DBGET integrated database retrieval system