KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_1420Help
Entry
SSUSC84_1420      CDS       T00937                                 

Definition
(GenBank) putative lipoprotein
Organism
sss  Streptococcus suis SC84 (serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Strep_his_triad LRR_4 LRR_8 LRR_9
Motif
Other DBs
NCBI-ProteinID: CAZ52196
LinkDB All DBs
Position
complement(1501087..1503663)
Genome map
AA seq 858 aa AA seqDB search
MKKKTTLFALTGIILSCHLFLAGCQKTENTAINHQDVQSSNISKVDENTIVVSEIKSNGY
MRLYGEESYFFEGPIPYAAHFLKDTLPDSDYKLNKEDIQYQLEKGYIIKVNEQYFYYPKD
KDANVISISEAKKLTKNQKKPTSQAKKGVAGVDYPTDDGFLFENEGQILSKTDEGLVLEH
NGHSHFIFYKDLKESKWSYLVPKEYIENSQSSSHSNAKQAKLSQTFDDGYVFDPKDVVAE
DANGYTVRHGDHYHYIWKSSLQYGQGNTGETIGKKGQITVLDNHSLHTPTTRNNFVPLKS
TTEKGHTSTQSNSKKAFPGIDYPTSDGFLFDGSGVQGQTALGLLIGHGTHTHLLPYSHLI
GSPWESYIPTQYLETARAEYHSSTSTQVNVEIPLSPQEGGKPNSSVEEEREAKKSYLAEN
LHVSKAKIKVIETDAGPAFVYPHGDHSHTILIEKVEVGKPIEDPHGDPHAHDKIGMATLK
QLGFDDEIIEDILHATADTPFPSNETDSEKMREWLKTVKYLNIGQRKDPLKRAGLDLMPN
VEVLGIGFTPIDDVKPILQFKKLKQLWMTSTGVKDYQFLKEIPTLEGIDLSQNGVSDLGF
LEEFPNLKVVSAAGNDIEDITILAKLKALESLNLDHNKVTDLSPLADLSQLTAVSLDNNR
ITDLSALQNKKKLTRLYISQNPQLDISTLKTENLEELTANESNVKDLQFVKNNPNLTSLT
LKNNKITELQGIEENEKLVNLDVEGNQIKTLEIEGKQESVVRLNVADNQLKNLEGVNDYK
ALEDLNASKNDIETLAITEPNKTLKTIDVSENHIPKEELNLNDQKIPSAIAEHFPAVEGG
SIENNQPKEVDKEAKVSE
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacaaccttatttgccttgacaggcattatcctatcttgtcatcttttt
ttggcgggttgccaaaaaacagagaatactgcaataaatcatcaagatgttcaaagtagc
aatatctcaaaagtagatgaaaatacgattgtagtgtctgaaattaaatctaatggctat
atgcgtctatatggagaagagtcatacttttttgaaggtccgatcccgtatgcggcacac
tttttaaaagatacccttccagattctgattataaattgaataaagaagatattcagtat
cagctagagaaaggttatattataaaagtaaatgagcagtacttctactatcccaaggat
aaagatgctaatgtaatttctatttctgaagctaagaaactcaccaaaaatcaaaagaaa
cctacttctcaagctaaaaaaggggtagctggtgttgattatcctacggatgatggattt
ctttttgaaaatgaaggtcaaattctttcaaaaacggatgagggactggtcttagaacat
aatggtcattcacattttatcttctataaggatttaaaagaaagcaaatggtcctatctg
gtacccaaagagtacattgagaatagccaatccagctcgcattccaacgcaaagcaagcg
aagctatcacaaacttttgatgatggttatgtatttgatccgaaggatgtagtggctgaa
gatgcgaatggctatacggtacgtcatggagatcattatcattatatttggaaatcaagt
ttgcaatacggacaaggaaatactggggagaccattggaaaaaagggacagattactgtt
cttgataatcattcgttgcatactccgaccacaagaaataatttcgtcccactcaagtct
accacagaaaaagggcatacttccactcagtctaattcaaagaaagctttcccaggtatt
gattatccaacaagcgacggtttcctttttgatggtagcggagtccaaggtcaaacagcg
ttagggttactcattggccatggtactcatactcatttacttccgtacagtcatttgata
ggaagtccgtgggagtcttatattcctactcagtatttagagactgctagagcagaatac
cattcgtcaacttccactcaagttaatgtagaaattccgttgtcaccacaagaaggtggg
aaacctaactcaagtgtagaagaagaacgagaagctaaaaagagctacctagccgaaaac
ctgcatgtttcaaaagcaaaaatcaaggtgatagaaacagatgcaggacctgctttcgtt
taccctcatggtgaccattctcatacaatcttgattgagaaagttgaagttggaaaacca
atcgaagaccctcacggtgacccacatgctcatgataaaattggaatggctactttaaaa
caattaggttttgatgatgagattattgaagatattttgcatgctacggccgatactcct
ttcccatctaatgaaacagattccgagaagatgagagagtggttaaaaacggtaaaatat
ctaaatattggtcagcgaaaagatccgctaaagagagccggtctggacttgatgccaaat
gttgaagtgttagggattggttttacgccaattgatgatgtaaaacctatcttgcaattt
aaaaaattgaaacaattatggatgactagcacaggcgttaaggattatcaatttttgaaa
gaaattccaacattagagggaattgacttatcacaaaatggtgtttctgatttgggcttt
ttggaagaatttccaaacttaaaagtagtttctgctgcaggaaatgacattgaagatatc
actattctagctaaattaaaagctttggaatctttaaatttagatcataataaagtgacg
gatttatccccattagcagatttgtcacaattgacagctgttagtttagataataatcgt
atcacagatttatctgcgcttcaaaacaagaagaagttaacccgtttgtatatatcacag
aatcctcaattggatatatcaactctaaaaacagagaatttagaagaactgacagctaat
gaaagtaatgtaaaagatcttcagtttgtaaaaaacaatccaaatttaactagtcttact
cttaagaataataagattactgaattacaagggatagaagaaaatgaaaaattagtaaat
ctggatgtagaggggaatcaaattaagactttggaaatagagggtaaacaagaatcggtt
gttcgattaaatgttgcagataatcaattgaagaatttagaaggagtcaatgattacaaa
gccttagaagacctgaatgcttcaaaaaatgatattgaaacacttgccattacagagccg
aataagactttgaaaacaattgatgtgagtgaaaatcacattccgaaggaagaattaaat
ctaaatgatcagaagatcccatctgcgattgcagaacattttccagcagttgaaggtggc
agtattgagaacaatcaacctaaagaagttgataaggaagcaaaggtaagcgagtaa

DBGET integrated database retrieval system