KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_1624Help
Entry
SSUSC84_1624      CDS       T00937                                 

Gene name
accC
Definition
(GenBank) biotin carboxylase subunit of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00061  Fatty acid biosynthesis
sss00620  Pyruvate metabolism
sss00640  Propanoate metabolism
sss01100  Metabolic pathways
sss01110  Biosynthesis of secondary metabolites
sss01120  Microbial metabolism in diverse environments
sss01130  Biosynthesis of antibiotics
sss01200  Carbon metabolism
sss01212  Fatty acid metabolism
Module
sss_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUSC84_1624 (accC)
   00640 Propanoate metabolism
    SSUSC84_1624 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SSUSC84_1624 (accC)
Enzymes [BR:sss01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SSUSC84_1624 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SSUSC84_1624 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CAZ52400
LinkDB All DBs
Position
complement(1695969..1697342)
Genome map
AA seq 457 aa AA seqDB search
MFEKILIANRGEIAVRIIRSARELGIATVAVYSEADKEALHTMLADEAVCIGPARSTDSY
LNMQAVISAAVVTGAQAIHPGFGFLSENSKFATLCEEVGIKFIGPSGTVMDTMGDKINAR
AEMVKAQVPVIPGSDGEVLTSQEALEIAEKIGYPVMLKASAGGGGKGIRKVEKAEDLVPA
FESASSEAKAAFDNGAMYIERVVYPARHIEVQILADQHGHVIHLGERDCSLQRNNQKVLE
EAPSIAIGQTMRERIGQAAVRAAQSVGYENAGTIEFLLDEAKGEFYFMEMNTRVQVEHPV
TEFVTGVDIVKEQIKIAAGQELSVRQEDVKITGHAIECRINAENPAFNFAPSPGKISTLY
LPSGGVGLRVDSAVYPGYTIPPYYDSMIAKVIVHGENRFEALMKMQRALYELEIDGVVTN
TDFQLDLISDKRVVAGDYDTAYLMEEFLPRYQEDLKK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaagattttgattgctaatcgtggtgagattgcggtgcggatcattcgttcg
gccagagagttggggattgcgacggtggctgtctattcagaggctgacaaggaagctctc
cacaccatgttggcagatgaggctgtctgtatcggcccagcccgttcgacagactcctat
ctcaatatgcaggcagtcatctcggcggctgttgtgacaggtgcccaggccattcatcct
ggctttggatttttgagtgaaaactccaaattcgccaccctctgtgaagaggttggtatc
aagttcatcggaccttctgggacggttatggataccatgggcgataaaatcaacgcgcgg
gcggagatggttaaggctcaagtgcctgttattccaggctctgacggtgaagttttgacc
agtcaagaagcccttgaaatcgctgaaaagattggctaccctgtcatgctcaaggcatcg
gcaggtggtggcggtaaggggattcgtaaggtggaaaaagctgaagacctagtgcctgcc
ttcgaatcggcttccagcgaagccaaagcagcctttgataacggagctatgtatatagag
cgtgttgtctatccagctcgccatatcgaagtacagattttggcggatcagcatggtcat
gtcattcatttgggagaacgggattgttcccttcaacgcaataaccaaaaagttttagaa
gaagctccgtcaattgctatcggtcagaccatgcgggaacgtatcggtcaagcagcagtg
cgggctgcccagtcagttggatatgaaaatgcaggaaccattgagtttcttttggacgaa
gccaagggcgaattttacttcatggaaatgaacacacgggtgcaggtggaacatcctgtt
accgaatttgtcaccggtgtggacattgtcaaggagcaaatcaagattgcggctggtcag
gaactcagtgtccgccaagaagatgtgaagattactggtcatgccattgaatgccgcatc
aatgctgaaaatccagccttcaacttcgccccaagtccaggtaagatttccactctctac
ctgccaagtggtggcgttggtttgcgtgtagattcagctgtttatccaggctacaccatt
ccgccttactatgattctatgattgccaaggtcatcgtgcatggggaaaatcgttttgaa
gccctgatgaagatgcagcgagccctctacgaattggaaattgacggagtggtgaccaat
acggacttccagctggacttgatttccgacaagcgagtggtggctggtgattatgacact
gcctacctcatggaagaatttttaccccgctatcaagaagatctaaaaaagtaa

DBGET integrated database retrieval system