KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_1660
Entry
SSUSC84_1660      CDS       T00937                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00010  Glycolysis / Gluconeogenesis
sss00020  Citrate cycle (TCA cycle)
sss00620  Pyruvate metabolism
sss01100  Metabolic pathways
sss01110  Biosynthesis of secondary metabolites
sss01120  Microbial metabolism in diverse environments
sss01200  Carbon metabolism
Module
sss_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUSC84_1660 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SSUSC84_1660 (pdhC)
   00620 Pyruvate metabolism
    SSUSC84_1660 (pdhC)
Enzymes [BR:sss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSUSC84_1660 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: CAZ52436
LinkDB
Position
complement(1737802..1739190)
AA seq 462 aa
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GSGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPVAVETAAPVPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggcgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgctgaaggt
gaaacggttgaagccggcgcttcatctgctcctgctgttgaaccagcagcggctattgaa
gaagtacctgcgggtcgtacaccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtagtggcaaggtgcgtgcaacgccagctgcgcgtaaattggcgcgtgagcttggaatc
gacttgggtcttgttccaggaacaggtgctaacggtcgtgtccacaaggttgacgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcagaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaacgac
gttcttgcagtacttgctcctgtagctgtagaaactgctgctccagtaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcatcaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccgacatttacacttaac
tacgatattgacatgaccaacctcatggcacttcgtaagcaagtccttgagccaatcatg
aacaagactggtttgaaagtaacctttacagacttgatcggtcttgcggttgttcgtact
ttgatgaaagaagaacaccgttacatgaacgcatctttgattaacgatgcacaagaaatc
gaattacacaagttcgtcaaccttggtatcgcagtgggtctagatgatggcttggtggtt
ccagttgttcacggcgcagataagatgagcttgtctgactttgtggtggcttcgaaagat
gtcatcaagaaggctcaatctggtaagttgaagggggctgaaatgtcaggttcgaccttc
tctatcaccaacttgggtatgtttggtactaaaacctttaacccaatcatcaaccaacca
aactcagcaatccttggtgtagcatcaactgttcaaacaccagttgttattgacggcgaa
atcaagatccgtccaatcatggcactctgcttaaccatcgaccaccgtatcattgatggt
atgaatggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatctga

DBGET integrated database retrieval system