KEGG   Streptococcus suis ST3 (serotype 3): SSUST3_0554Help
Entry
SSUST3_0554       CDS       T01470                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sst  Streptococcus suis ST3 (serotype 3)
Pathway
sst00620  Pyruvate metabolism
sst00680  Methane metabolism
sst01100  Metabolic pathways
sst01120  Microbial metabolism in diverse environments
sst01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUST3_0554 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SSUST3_0554 (ppc)
Enzymes [BR:sst01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SSUST3_0554 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEB81017
LinkDB All DBs
Position
546391..549087
Genome map
AA seq 898 aa AA seqDB search
MAIQKLENYNNKEAIREEVTILTSILEKVAAQMMPAETFAKIVELSQLSRQDDYRALIAI
ISQLNNDELAVISRYFAVLPLLINISEDVDLAYEINHQNNIDQDYLGKISTTIDMVSKQE
NAAEILEKLNVVPVLTAHPTQVQRQSMLDLTKHIHELLRRYRDVKLGLLNKNKWEDELRC
YIEIIMQTDMIREKKLKVTNEITNVMEYYNSSFIKAVTKLQREYKRLAAEKGIVLNNPRP
ITMGMWIGGDRDGNPFVTAETLKLSALTQCEVIMNYYDEQLYKLYRNFSLSTSIVNVSTA
VKMLADLSEDSSVYRENEPYRRAFHYIQMKLANTRDYLVHNKPSDVRYSNVAEFKADLLA
IKQSLVENKSMALLKGDFTELLEAVEAFGFYLASIDMRQDSSIHEASVAELLASARIVED
YSSLSEEAKCHVLLKQLETDPRILSATHMPKSEQLEKELAIFAAARELKDKLGEEIIKQH
IISHSESVSDLLELAVLLKEVGLVDVDKARVQIVPLFETIEDLDNAPDTMRQYLQLDLAK
RWIAGNKYYQEIMLGYSDSNKDGGYLSSGWTLYKAQNELTQIGQDYGVNITFFHGRGGTV
GRGGGPSYDAITSQPFGSIKDRLRLTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTQ
MITDPNEIDGYRETMDEIVSDSYRIYRDLVFNNPHFYDYFFAASPIREVSSLNIGSRPAA
RKTITEIGGLRAIPWVFSWSQNRVMLPGWYGVGSSFKRFIDKHPDNLSKLQKMYESWPFF
RSLLSNVDMVLSKSNMNIAFEYAKMCESEEVRNIFHVILDEWQLTKEIILSIEQNDELLA
ELPFLKASLDYRMPYFNVLNYIQIELIHRLRRGELSKEQENLIHITINGVATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggctattcaaaaattagaaaactataacaacaaggaagcaatccgtgaagaagtaacg
attctaacatctattttggaaaaagtagcagcccaaatgatgcctgcagagacctttgct
aaaattgtagaattatctcaattgtctcgtcaggatgattatcgggcattgattgctatt
atcagtcagttgaataatgatgaactagcagttatttctcgatactttgctgttttgcca
cttttgattaatatatcagaagatgttgatttggcctatgaaatcaaccatcaaaacaat
attgatcaagattatcttggtaagatttcaacaacaattgatatggtttccaaacaagaa
aatgcagctgaaatccttgaaaagttgaatgttgttccagtcttgacagcccatcctact
caggttcaacgccagtctatgctggatttaaccaagcatattcatgagttgcttcgtcgt
tatcgcgatgtaaaattgggcttgctcaataaaaacaaatgggaagatgagctccgttgt
tacattgaaattatcatgcagacggatatgattcgtgagaagaagttgaaggtaaccaac
gaaatcacaaacgttatggagtattataattcttcctttattaaggctgtcactaagttg
cagcgggaatacaaacgtttggccgctgagaaaggaatcgtcttaaataatcctcgtcca
attacaatgggtatgtggattgggggagaccgtgatggaaatccatttgttactgcagag
accttgaagctgtccgccttgactcagtgtgaagtcattatgaattattacgatgaacaa
ctctataaactctatcggaatttttcactctcaacttccattgtaaatgtatctacagcg
gttaagatgctggcggatttatctgaagatagttctgtctaccgtgaaaatgagccttat
cgtcgtgcttttcactatattcagatgaaacttgcaaatacaagagattatctagttcac
aataagccgtcagatgttcgctatagtaatgtagccgagtttaaagctgacttattagcc
atcaaacaatctttggttgaaaataaatctatggcgctattgaaaggtgattttacagaa
ttgcttgaagcggttgaagcgtttggtttctacctagctagtatcgatatgcgccaagac
tcttctattcatgaagcaagtgttgcggagctattggcctctgcccgtatcgtagaagac
tactccagtttatctgaggaagctaaatgccatgttcttttgaaacagttggaaactgat
ccacgcattctttctgcaacgcacatgccaaagtcagaacaattagaaaaagaattggcc
atctttgctgctgcgcgtgaattgaaagataagctaggtgaggaaatcatcaagcaacat
attatttcacactcggagagtgtttctgatttgctggaattagctgtcctattaaaagaa
gttggtctagtagatgtcgataaggcccgtgttcagattgttccactttttgagacaatc
gaggacttagataatgcacctgataccatgcgtcaatatctgcaattagatttagcgaaa
cgttggattgcaggcaataaatactaccaagaaatcatgcttggctactcagattccaac
aaggatggtggctacctatcctccggctggacactctacaaagcacagaatgaattgacg
caaattggtcaagactacggagtaaacatcaccttcttccacggtcgtggtggtactgtt
ggtcgtggtgggggtccttcctatgatgcgattacatctcagccatttggttccatcaag
gaccggcttcgtttgacagaacaaggcgaagtgataggtaataaatacggtaacaaagac
gcagcctactataatttagaaatgctggtatctgcaacgcttgaccgtatggtcacacaa
atgattaccgatccaaatgaaatcgatggctatcgcgaaaccatggatgaaattgtatca
gatagctatcgtatttatagagatcttgtgttcaataatccacatttttatgattatttc
tttgccgctagtccaattcgtgaagtatcaagtctgaacattggctcacgtccagcggct
cgaaaaaccatcacagaaatcggtggtttgcgtgcgattccatgggtattctcttggtca
caaaaccgtgtcatgttgccaggttggtatggagttggttcaagtttcaaacgctttatt
gataagcaccctgataatttgtctaagttacaaaaaatgtacgaatcttggccattcttc
cgttcacttctatcaaacgtggatatggtattgtctaaatccaatatgaatatcgcattt
gaatatgctaaaatgtgtgaaagcgaagaggtacgaaatatcttccatgtcattttagat
gaatggcagttgaccaaagaaattattttgtcaatcgagcaaaatgatgagcttttagca
gaactaccgtttctaaaagctagtcttgactatcgcatgccttatttcaatgtgctcaac
tatattcagattgaattaattcatcgtcttcgtcgtggagaattgagcaaagaacaagag
aatctcattcatattaccatcaatggtgtggcgacaggtttgcgcaactcaggttaa

DBGET integrated database retrieval system