KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_0349Help
Entry
SSU05_0349        CDS       T00514                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
Pathway
ssu00220  Arginine biosynthesis
ssu00250  Alanine, aspartate and glutamate metabolism
ssu00290  Valine, leucine and isoleucine biosynthesis
ssu01100  Metabolic pathways
ssu01110  Biosynthesis of secondary metabolites
ssu01130  Biosynthesis of antibiotics
ssu01210  2-Oxocarboxylic acid metabolism
ssu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSU05_0349
   00290 Valine, leucine and isoleucine biosynthesis
    SSU05_0349
   00220 Arginine biosynthesis
    SSU05_0349
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssu01007]
    SSU05_0349
Enzymes [BR:ssu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SSU05_0349
    2.6.1.66  valine---pyruvate transaminase
     SSU05_0349
Amino acid related enzymes [BR:ssu01007]
 Aminotransferase (transaminase)
  Class I
   SSU05_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABP89316
UniProt: A4VT77
LinkDB All DBs
Position
337133..338347
Genome map
AA seq 404 aa AA seqDB search
MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAEFGFTAPDEVIRDLIH
NARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGKAVHYVCDEVAEWYPDLADMESKVTSRTKAIVLINPNNP
TGALYPKEILKGIIDIARRHELIIFSDEIYDRMVFDGAVHIPIATLAPDLFVVTMNGLSK
SHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
MPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDREMYRVEDDEQFVLDFLKQEK
VLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttaacaagtcaacaaaattggatgatgtagcatatgatattcgtgggcct
gttttggaagaggccatgcgcatgcgtgccaatggagagcagattttacgtttgaatacg
gggaatcctgcagaatttggttttactgctccagatgaagttattcgtgacttgattcat
aacgcccgtaaatcagagggatattcgaacagtaagggaattttttctgcacgtaaggct
atcatgcagtattgtcagctaaagaaatttccaaatgttgacattgaagatatttatctt
ggaaacggcgtgagtgagctgattgttatgtctatgcaaggtttgctagataatggtgat
gaggtgttggtgccaatgccagactatcctctctggactgctgcagttagtttggctggt
ggtaaagctgttcactatgtttgtgatgaagtagctgaatggtatccagatttggcagat
atggagtccaaggtgacttctcgaaccaaggcaattgtccttatcaatccaaataatcca
actggtgctctctatccgaaagaaattttaaaaggaatcattgatattgctcgtagacat
gaattgatcattttctctgatgagatttatgatcgtatggtctttgatggagctgttcat
atccctattgcgacactggctccagatttatttgttgtgacgatgaatggactgtctaaa
tcacatcgtatttgtggtttccgagtaggttggatggtcttatctggtccgaaaaagcat
gtaaaaggttacattgaaggcttgaatatgttgtccaatatgcgtttgtgttcaaacgtt
ttggctcaacaggttgttcaaacttctttgggaggttaccaatcggttgatgagctcttg
atgcctggcggacgcttatatgaacaaagggagttcattaccaaggcgattaatgatatt
ccgggactttctgctgtaaaacctaaggctggtctgtatgtattcccaaaaattgatcgt
gagatgtacagagttgaggatgatgaacaatttgtattggatttcctcaagcaagaaaaa
gtacttttggtccatggtcgaggttttaactggaaggatccagatcatttccgtattgtg
tatttaccacgtgttgatgagttggcagaaattcaagaaaaaatgtcacgattcttgcgg
caatatcgtagataa

DBGET integrated database retrieval system