KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_1102Help
Entry
SSU05_1102        CDS       T00514                                 

Definition
(GenBank) ABC-type phosphate transport system, ATPase component
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
Pathway
ssu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ssu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSU05_1102
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssu02000]
    SSU05_1102
Enzymes [BR:ssu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     SSU05_1102
Transporters [BR:ssu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    SSU05_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_15 SMC_N AAA_21 AAA_22 RsgA_GTPase Rad17 AAA_28 AAA_29 AAA_23 AAA AAA_16 Adeno_IVa2 AAA_33 AAA_14 AAA_18 AAA_7 G-alpha MMR_HSR1 AAA_30 ATPase_2 RNA_helicase NB-ARC Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ABP90068
UniProt: A4VVC9
LinkDB All DBs
Position
complement(1064153..1064938)
Genome map
AA seq 261 aa AA seqDB search
MNAISLLFQRSNIALSTKDVHVYYGKNEAIKGIDMQFEKNKITALIGPSGCGKSTYLRSL
NRMNDTIDIAKVTGQILYEGIDINRPDMNVYEIRKHIGMVFQRPNPFAKSIYRNITFAHE
RAGVKDKQVLDEIVETSLKQAALWDQVKDDLHKSAFTLSGGQQQRLCIARAISVKPQILL
MDEPASALDPIATMQLEETMFELKKDYTIIIVTHNMQQAARASDYTAFFYLGDLIEYDKT
ANVFQNAKLKSTSDYVSGHFG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatatcattacttttccagaggagcaatatcgccctttcgacaaaagatgtt
catgtttactatggtaaaaatgaagcaatcaagggcattgatatgcagttcgaaaaaaat
aaaattacagccttgattggaccatcagggtgtgggaaatcaacctatcttcgcagtctt
aatcgtatgaatgatactattgatattgctaaggtaaccggtcaaattctttatgaagga
atcgacatcaatagaccagatatgaacgtttacgaaattcgtaagcatatcggaatggta
ttccaacgtcccaacccatttgcaaaatcgatttatcgcaacatcacattcgcacatgaa
cgtgcaggtgtgaaagataagcaggttttggatgagattgttgaaacttctctgaaacaa
gcagccctttgggatcaggtaaaagatgacttgcacaagtcagcctttaccttatcaggt
ggacagcaacagcgtttgtgtattgcacgagctatctctgtaaaaccacaaatcttgctt
atggatgagcctgcatcagccttggatccaattgcgactatgcagttagaagaaactatg
tttgaattgaagaaggactacaccattatcattgttacgcacaatatgcaacaagcagct
cgtgcaagtgattacacagctttcttctatctgggtgacttgattgaatatgataagaca
gcaaatgtcttccagaatgcaaaactcaagtcaactagtgactacgtttcaggacatttt
ggatag

DBGET integrated database retrieval system