KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_1352Help
Entry
SSU05_1352        CDS       T00514                                 

Definition
(GenBank) D-alanine-D-alanine ligase and related ATP-grasp enzymes
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
Pathway
ssu00473  D-Alanine metabolism
ssu00550  Peptidoglycan biosynthesis
ssu01100  Metabolic pathways
ssu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSU05_1352
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSU05_1352
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SSU05_1352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssu01011]
    SSU05_1352
Enzymes [BR:ssu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSU05_1352
Peptidoglycan biosynthesis and degradation proteins [BR:ssu01011]
 Precursor biosynthesis
  Amino acid ligase
   SSU05_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ABP90318
UniProt: A4VW29
LinkDB All DBs
Position
complement(1294011..1295285)
Genome map
AA seq 424 aa AA seqDB search
MLNYAILRVIALIQEGKYMSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYF
ISQTGDFIKTQEFSQTPSADEKLMTNATIVEEQKIRPSDIYEEKAVVFPVLHGPMGEDGS
IQGFLEVLRMPYVGTNILSSSVAMDKITTKRVLESAGISQVPYVAVIEGENIDDKIAEIE
GKLTYPVFVKPANMGSSVGISKAEDLAGLRKALDLAFKYDSRVLVEQGVNAREIEVGLLG
NADVKTKLPGEVVKNVAFYDYHAKYIDNKIPMEIPAKIDESIMDIMRDNAAKAFRAIGGC
GLSPCDFFLTENGEIFLNELNTMPGFTQWFMYPLLWDNMGLGYPELIEKLVCLAKEMFEN
TRNVTSFNYYQDWDHFNFFFCKGLPKEIKWDKFWRCLCIKRQLKGEVCFRVFFKDMANRF
VPLG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaattatgctatactaagagtaatagcgttgatacaggaaggaaaatatatgtca
aaagaaaccttgattttactatatggtgggcgttctgcagagcgtgaggtatctgttctg
tctgccgaaagcgtcatgcgtgctatcaattatgataaattttttgtcaaaacctatttc
attagccagaccggggactttattaagacgcaagagttttctcaaacaccgtctgccgat
gaaaaactcatgacaaacgcgacgattgttgaagagcaaaaaatccgtccgagcgatatt
tatgaagaaaaggcggttgttttccctgttcttcatggcccaatgggagaagacggatct
attcaaggcttcttggaagtgcttcgtatgccttatgttggcactaatatcttgtcttca
agcgttgctatggacaaaatcactaccaagcgcgtacttgaatcagcaggaatctcccag
gtaccttatgtggcagttatcgagggtgaaaatatcgacgataagattgcagagattgaa
ggaaaattgacttatccggtctttgtaaaaccagctaatatggggtcaagtgtcggtatc
tcaaaagctgaggatttagctggcttgcgtaaggcacttgatctggccttcaagtatgat
agccgtgtcctcgttgagcagggtgttaatgcgcgtgagattgaggtcggtcttttggga
aatgctgacgtgaaaacgaaacttcctggcgaagtagtcaaaaacgttgctttttatgac
taccatgccaaatacatcgacaacaaaatccccatggaaatcccagctaaaattgatgaa
tctatcatggatatcatgcgtgataatgctgccaaggccttccgtgctatcggtggttgt
ggactttctccctgtgattttttcctgactgaaaacggggaaatcttcctaaacgaactc
aataccatgccaggtttcacccaatggtttatgtatccactcctttgggataatatgggc
ctaggttatccagaattgattgaaaaacttgtttgtttggctaaggaaatgtttgaaaat
acgcgaaacgtcacctcatttaattattatcaagattgggatcatttcaatttttttttt
tgcaaaggtttgccaaaagaaataaaatgggacaagttttggaggtgtttatgtatcaaa
cgacagttaaagggggaggtttgttttagggttttttttaaggatatggcgaatcggttt
gtacctttggggtaa

DBGET integrated database retrieval system