KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_1839Help
Entry
SSU05_1839        CDS       T00514                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
Pathway
ssu00010  Glycolysis / Gluconeogenesis
ssu00020  Citrate cycle (TCA cycle)
ssu00620  Pyruvate metabolism
ssu01100  Metabolic pathways
ssu01110  Biosynthesis of secondary metabolites
ssu01120  Microbial metabolism in diverse environments
ssu01130  Biosynthesis of antibiotics
ssu01200  Carbon metabolism
Module
ssu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU05_1839
   00020 Citrate cycle (TCA cycle)
    SSU05_1839
   00620 Pyruvate metabolism
    SSU05_1839
Enzymes [BR:ssu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSU05_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABP90805
UniProt: A4VXG6
LinkDB All DBs
Position
complement(1738164..1739552)
Genome map
AA seq 462 aa AA seqDB search
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GSGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPVAVETAAPVPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggcgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgctgaaggt
gaaacggttgaagccggcgcttcatctgctcctgctgttgaaccagcagcggctattgaa
gaagtacctgcgggtcgtacaccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtagtggcaaggtgcgtgcaacgccagctgcgcgtaaattggcgcgtgagcttggaatc
gacttgggtcttgttccaggaacaggtgctaacggtcgtgtccacaaggttgacgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcagaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaacgac
gttcttgcagtacttgctcctgtagctgtagaaactgctgctccagtaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcatcaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccgacatttacacttaac
tacgatattgacatgaccaacctcatggcacttcgtaagcaagtccttgagccaatcatg
aacaagactggtttgaaagtaacctttacagacttgatcggtcttgcggttgttcgtact
ttgatgaaagaagaacaccgttacatgaacgcatctttgattaacgatgcacaagaaatc
gaattacacaagttcgtcaaccttggtatcgcagtgggtctagatgatggcttggtggtt
ccagttgttcacggcgcagataagatgagcttgtctgactttgtggtggcttcgaaagat
gtcatcaagaaggctcaatctggtaagttgaagggggctgaaatgtcaggttcgaccttc
tctatcaccaacttgggtatgtttggtactaaaacctttaacccaatcatcaaccaacca
aactcagcaatccttggtgtagcatcaactgttcaaacaccagttgttattgacggcgaa
atcaagatccgtccaatcatggcactctgcttaaccatcgaccaccgtatcattgatggt
atgaatggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatctga

DBGET integrated database retrieval system