KEGG   Streptococcus suis T15: T15_1897Help
Entry
T15_1897          CDS       T02891                                 

Gene name
aceF
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssui  Streptococcus suis T15
Pathway
ssui00010  Glycolysis / Gluconeogenesis
ssui00020  Citrate cycle (TCA cycle)
ssui00620  Pyruvate metabolism
ssui01100  Metabolic pathways
ssui01110  Biosynthesis of secondary metabolites
ssui01120  Microbial metabolism in diverse environments
ssui01130  Biosynthesis of antibiotics
ssui01200  Carbon metabolism
Module
ssui_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T15_1897 (aceF)
   00020 Citrate cycle (TCA cycle)
    T15_1897 (aceF)
   00620 Pyruvate metabolism
    T15_1897 (aceF)
Enzymes [BR:ssui01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     T15_1897 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AGZ23977
UniProt: U5UGW2
LinkDB All DBs
Position
complement(1877727..1879115)
Genome map
AA seq 462 aa AA seqDB search
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GSGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPVAVETAAPVPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSEFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVAATVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggcgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgctgaaggt
gaaacggttgaagccggcgcttcatctgctcctgctgttgaaccagcagcggctattgaa
gaagtacctgcgggtcgtacaccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtagtggcaaggtgcgtgcaacgccagctgcgcgtaaattggcgcgtgagcttggaatc
gacttgggtcttgttccaggaacaggtgctaacggtcgtgtccacaaggttgacgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcagaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaacgac
gttcttgcagtacttgctcctgtagctgtagaaactgctgctccagtaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcattaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccaacctttacgcttaat
tacgatatcgacatgaccaacctcatggcgcttcgtaagcaagtccttgagccaattatg
aacaagactggtctgaaagtgacctttacagacttgattggtctcgcggttgttcgtacg
ttgatgaaagaagaacaccgttacatgaacgcttctttgattaacgatgcacaagaaatc
gaattacacaagtttgtcaaccttggtatcgcagtaggtttagatgatggcttggtggtg
ccagttgttcatggtgcagataagatgagcttgtctgaatttgttgtggcatcaaaagat
gttatcaagaaagctcaatctggtaagttgaagggggctgaaatgtcaggatctaccttc
tctatcacgaacttgggtatgtttggtaccaaaacctttaacccaattatcaaccaacca
aactcagcaatccttggtgtagcagcaactgttcaaactccagtagttattgatggtgaa
atcaaaatccgtccaattatggcactttgcttgaccattgaccaccgcatcattgatggt
atgaatggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatctga

DBGET integrated database retrieval system