KEGG   Streptococcus suis SC070731 (serotype 2): NJAUSS_0332Help
Entry
NJAUSS_0332       CDS       T02536                                 

Definition
(GenBank) aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssus  Streptococcus suis SC070731 (serotype 2)
Pathway
ssus00220  Arginine biosynthesis
ssus00250  Alanine, aspartate and glutamate metabolism
ssus00290  Valine, leucine and isoleucine biosynthesis
ssus01100  Metabolic pathways
ssus01110  Biosynthesis of secondary metabolites
ssus01130  Biosynthesis of antibiotics
ssus01210  2-Oxocarboxylic acid metabolism
ssus01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NJAUSS_0332
   00290 Valine, leucine and isoleucine biosynthesis
    NJAUSS_0332
   00220 Arginine biosynthesis
    NJAUSS_0332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssus01007]
    NJAUSS_0332
Enzymes [BR:ssus01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NJAUSS_0332
    2.6.1.66  valine---pyruvate transaminase
     NJAUSS_0332
Amino acid related enzymes [BR:ssus01007]
 Aminotransferase (transaminase)
  Class I
   NJAUSS_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGG63819
LinkDB All DBs
Position
340453..341667
Genome map
AA seq 404 aa AA seqDB search
MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAEFGFTAPDEVIRDLIH
NARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGKAVHYVCDEVAEWYPDLADMESKVTSRTKAIVLINPNNP
TGALYPKEILKGIIDIARRHELIIFSDEIYDRMVFDGAVHIPIATLAPDLFVVTMNGLSK
SHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
MPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDREMYRVEDDEQFVLDFLKQEK
VLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttaacaagtcaacaaaattggatgatgtagcatatgatattcgtgggcct
gttttggaagaggccatgcgcatgcgtgccaatggagagcagattttacgtttgaatacg
gggaatcctgcagaatttggttttactgctccagatgaagttattcgtgacttgattcat
aacgcccgtaaatcagagggatattcgaacagtaagggaattttttctgcacgtaaggct
atcatgcagtattgtcagctaaagaaatttccaaatgttgacattgaagatatttatctt
ggaaacggcgtgagtgagctgattgttatgtctatgcaaggtttgctagataatggtgat
gaggtgttggtgccaatgccagactatcctctctggactgctgcagttagtttggctggt
ggtaaagctgttcactatgtttgtgatgaagtagctgaatggtatccagatttggcagat
atggagtccaaggtgacttctcgaaccaaggcaattgtccttatcaatccaaataatcca
actggtgctctctatccgaaagaaattttaaaaggaatcattgatattgctcgtagacat
gaattgatcattttctctgatgagatttatgatcgtatggtctttgatggagctgttcat
atccctattgcgacactggctccagatttatttgttgtgacgatgaatggactgtctaaa
tcacatcgtatttgtggtttccgagtaggttggatggtcttatctggtccgaaaaagcat
gtaaaaggttacattgaaggcttgaatatgttgtccaatatgcgtttgtgttcaaacgtt
ttggctcaacaggttgttcaaacttctttgggaggttaccaatcggttgatgagctcttg
atgcctggcggacgcttatatgaacaaagggagttcattaccaaggcgattaatgatatt
ccgggactttctgctgtaaaacctaaggctggtctgtatgtattcccaaaaattgatcgt
gagatgtacagagttgaggatgatgaacaatttgtattggatttcctcaagcaagaaaaa
gtacttttggtccatggtcgaggttttaactggaaggatccagatcatttccgtattgtg
tatttaccacgtgttgatgagttggcagaaattcaagaaaaaatgtcacgattcttgcgg
caatatcgtagataa

DBGET integrated database retrieval system