KEGG   Streptococcus suis TL13 (serotype 16): TL13_1627Help
Entry
TL13_1627         CDS       T02672                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssut  Streptococcus suis TL13 (serotype 16)
Pathway
ssut00010  Glycolysis / Gluconeogenesis
ssut00020  Citrate cycle (TCA cycle)
ssut00620  Pyruvate metabolism
ssut01100  Metabolic pathways
ssut01110  Biosynthesis of secondary metabolites
ssut01120  Microbial metabolism in diverse environments
ssut01130  Biosynthesis of antibiotics
ssut01200  Carbon metabolism
Module
ssut_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TL13_1627 (pdhC)
   00020 Citrate cycle (TCA cycle)
    TL13_1627 (pdhC)
   00620 Pyruvate metabolism
    TL13_1627 (pdhC)
Enzymes [BR:ssut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TL13_1627 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AGL48552
LinkDB All DBs
Position
complement(1637771..1639159)
Genome map
AA seq 462 aa AA seqDB search
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEADASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GGGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPAAVETAAPAPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgatttcgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggcgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgctgaaggt
gaaacggttgaagccgacgcttcatctgctcctgctgttgaaccagcagcggctattgaa
gaagtacctgcaggtcgtacgccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtggtggcaaggttcgtgcgactccagcagcacgtaaattggcgcgtgagcttggaatc
gacttgggtcttgttccaggaacaggtgctaacggtcgtgtccacaaggttgacgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcagaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaacgac
gttcttgcagtacttgctcctgcagctgtagaaactgcagctccagcaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcatcaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccgacatttacacttaac
tacgatattgacatgactaacctcatggcacttcgtaagcaagtccttgagccaatcatg
aacaagactggtttgaaagtaacctttacagacttgatcggtcttgcggttgttcgtact
ttgatgaaagaagaacaccgctacatgaacgcatctttgattaacgatgcccaagaaatc
gaattacacaagttcgtcaaccttggtatcgcagtgggtctagatgatggcttagtggtt
ccagttgttcacggcgcagataagatgagcttgtctgactttgtggtggcttcgaaagat
gtcatcaagaaggctcaatctggtaagttgaagggggctgaaatgtcaggttcgaccttc
tctatcaccaacttgggtatgtttggtactaaaacctttaacccaatcatcaaccaacca
aactcagcaatccttggtgtagcatcaactgttcaaacaccagttgttattgacggcgaa
atcaaaatccgtccaatcatggcactctgcttgaccatcgaccaccgtatcattgatggt
atgaatggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatttaa

DBGET integrated database retrieval system