KEGG   Streptococcus suis YB51 (serotype 3): YB51_1785Help
Entry
YB51_1785         CDS       T03173                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A / Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ssuy  Streptococcus suis YB51 (serotype 3)
Pathway
ssuy00970  Aminoacyl-tRNA biosynthesis
ssuy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssuy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YB51_1785
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssuy03029]
    YB51_1785
Enzymes [BR:ssuy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     YB51_1785
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     YB51_1785
Mitochondrial biogenesis [BR:ssuy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YB51_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGW86729
LinkDB All DBs
Position
365478..366944
Genome map
AA seq 488 aa AA seqDB search
MTFNNKTIDELHDLLVKKEISALELTKATLEDIKSREGAVDAFLTITEDAALAQAAALDE
KGIDADNVMAGIPLAVKDNISTKGILTTAASKMLYNYEPIFDATSVSQAYAKDMIVVGKT
NMDEFAMGGSNENSAFKPTKNAWDQTKVPGGSSGGSAAAVAAGQVRLSLGSDTGGSIRQP
AAFNGIVGMKPTYGTVSRFGLIAFGSSLDQIGPFSQTVKENAQLLNVISGHDVKDATSTI
NEIADFTSKIGQDIKGMKIALPKEYMGEGIDPQVKETILKAAKHLESLGAIIEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGFRAEDATNLEEIYVKTRSQGFGEEVKRRIMLG
TFSLSSGYYDACFKKAGQVRTLIIQDFEKVFADYDLILGPTAPTVAFGLDTLNHDPVAMY
LADLLTIPVNLAGLPGLSIPAGFVEGLPVGLQLIGPKYSEETIYQVAAAFEATTDYHKQQ
PVIFGGAN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacctttaacaataaaaccattgatgaattgcatgacctccttgtcaaaaaggagatt
tcggctcttgagttgaccaaggcaactttggaagacattaagagccgtgagggagcagtg
gatgctttcttgactatcacagaagatgcggccttggcgcaggctgctgcccttgatgaa
aaagggattgatgcggacaatgttatggcagggattcctttggcagtcaaggacaatatc
tctactaaggggattttgaccacggcagcttcaaaaatgctctataactacgagccgatt
ttcgatgcgacatcggtttcccaagcctatgccaaggatatgattgttgttggtaagacc
aacatggatgagtttgctatgggtggttctaatgagaactcagccttcaaaccgaccaaa
aatgcttgggaccagacaaaagttcctggtggttcttcaggtggctcagctgctgcagtt
gcggctggtcaagtccgtttatcactcggttctgacacaggtggctctatccgtcaacca
gcagcctttaatggtatcgtcggtatgaaaccgacctatggaacggtgtcacgttttggt
ttaattgcctttggttcatctcttgaccagatcggtccattctcacagacggttaaggaa
aatgcccagttgctcaatgtcatctctggtcatgatgtcaaggatgcaacatcaaccatc
aatgaaattgcagactttactagcaagattggtcaggacatcaagggtatgaagattgct
ctgccaaaagaatacatgggagaagggattgatccgcaggtgaaggaaactattctcaag
gcggctaagcacttggaaagcttgggagcaatcattgaagaagtcagcctgccacattct
aagtatggggttgctgtttactacatcattgcttcatcagaggcgtcttctaacttgcaa
cgttttgacggtatccgttatggtttccgtgcagaagatgcgaccaacttggaagaaatc
tatgtgaaaacccgtagccaaggttttggtgaggaagtcaaacgtcgtattatgttaggt
acatttagcttgtcatctggttactacgatgcctgcttcaagaaggctggtcaggtacgg
accttgattatccaggattttgaaaaagtctttgcagactatgacttgattttggggcca
acagctccgacggttgcctttggtttggacacgctcaaccatgaccctgtggctatgtac
ttggcggacttgttaacaattcctgtaaacttagcaggtcttcctggtctttctattcct
gctggttttgttgaaggcttgccagtcggtttgcagttgattggtccaaaatattcagaa
gagaccatttaccaagtggctgctgcctttgaagcgacaacagactaccacaagcaacaa
ccagtgatttttggaggtgctaactaa

DBGET integrated database retrieval system