KEGG   Streptococcus suis YB51 (serotype 3): YB51_2755Help
Entry
YB51_2755         CDS       T03173                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ssuy  Streptococcus suis YB51 (serotype 3)
Pathway
ssuy00620  Pyruvate metabolism
ssuy00680  Methane metabolism
ssuy01100  Metabolic pathways
ssuy01120  Microbial metabolism in diverse environments
ssuy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssuy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YB51_2755
  09102 Energy metabolism
   00680 Methane metabolism
    YB51_2755
Enzymes [BR:ssuy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     YB51_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGW86923
LinkDB All DBs
Position
554173..556869
Genome map
AA seq 898 aa AA seqDB search
MAIQKLENYNNKEAIREEVTILTSILEKVAAQMMPAETFAKIVELSQLSRQDDYRALIAI
ISQLNNDELAVISRYFAVLPLLINISEDVDLAYEINHQNNIDQDYLGKISTTIDMVSKQE
NAAEILEKLNVVPVLTAHPTQVQRQSMLDLTKHIHELLRRYRDVKLGLLNKNKWEDELRC
YIEIIMQTDMIREKKLKVTNEITNVMEYYNSSFIKAVTKLQREYKRLAAEKGIVLNNPRP
ITMGMWIGGDRDGNPFVTAETLKLSALTQCEVIMNYYDEQLYKLYRNFSLSTSIVNVSTA
VKMLADLSEDSSVYRENEPYRRAFHYIQMKLANTRDYLVHNKPSDVRYSNVAEFKADLLA
IKQSLVENKSMALLKGDFTELLEAVEAFGFYLASIDMRQDSSIHEASVAELLASARIVED
YSSLSEEAKCHVLLKQLETDPRILSATHMPKSEQLEKELAIFAAARELKDKLGEEIIKQH
IISHSESVSDLLELAVLLKEVGLVDVDKARVQIVPLFETIEDLDNAPDTMRQYLQLDLAK
RWIAGNKYYQEIMLGYSDSNKDGGYLSSGWTLYKAQNELTQIGQDYGVNITFFHGRGGTV
GRGGGPSYDAITSQPFGSIKDRLRLTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTQ
MITDPNEIDGYRETMDEIVSDSYRIYRDLVFNNPHFYDYFFAASPIREVSSLNIGSRPAA
RKTITEIGGLRAIPWVFSWSQNRVMLPGWYGVGSSFKRFIDKHPDNLSKLQKMYESWPFF
RSLLSNVDMVLSKSNMNIAFEYAKMCESEEVRNIFHVILDEWQLTKEIILSIEQNDELLA
ELPFLKASLDYRMPYFNVLNYIQIELIHRLRRGELSKEQENLIHITINGVATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggctattcaaaaattagaaaactataacaacaaggaagcaatccgtgaagaagtaacg
attctaacatctattttggaaaaagtagcagcccaaatgatgcctgcagagacctttgct
aaaattgtagaattatctcaattgtctcgtcaggatgattatcgggcattgattgctatt
atcagtcagttgaataatgatgaactagcagttatttctcgatactttgctgttttgcca
cttttgattaatatatcagaagatgttgatttggcctatgaaatcaaccatcaaaacaat
attgatcaagattatcttggtaagatttcaacaacaattgatatggtttccaaacaagaa
aatgcagctgaaatccttgaaaagttgaatgttgttccagtcttgacagcccatcctact
caggttcaacgccagtctatgctggatttaaccaagcatattcatgagttgcttcgtcgt
tatcgcgatgtaaaattgggcttgctcaataaaaacaaatgggaagatgagctccgttgt
tacattgaaattatcatgcagacggatatgattcgtgagaagaagttgaaggtaaccaac
gaaatcacaaacgttatggagtattataattcttcctttattaaggctgtcactaagttg
cagcgggaatacaaacgtttggccgctgagaaaggaatcgtcttaaataatcctcgtcca
attacaatgggtatgtggattgggggagaccgtgatggaaatccatttgttactgcagag
accttgaagctgtccgccttgactcagtgtgaagtcattatgaattattacgatgaacaa
ctctataaactctatcggaatttttcactctcaacttccattgtaaatgtatctacagcg
gttaagatgctggcggatttatctgaagatagttctgtctaccgtgaaaatgagccttat
cgtcgtgcttttcactatattcagatgaaacttgcaaatacaagagattatctagttcac
aataagccgtcagatgttcgctatagtaatgtagccgagtttaaagctgacttattagcc
atcaaacaatctttggttgaaaataaatctatggcgctattgaaaggtgattttacagaa
ttgcttgaagcggttgaagcgtttggtttctacctagctagtatcgatatgcgccaagac
tcttctattcatgaagcaagtgttgcggagctattggcctctgcccgtatcgtagaagac
tactccagtttatctgaggaagctaaatgccatgttcttttgaaacagttggaaactgat
ccacgcattctttctgcaacgcacatgccaaagtcagaacaattagaaaaagaattggcc
atctttgctgctgcgcgtgaattgaaagataagctaggtgaggaaatcatcaagcaacat
attatttcacactcggagagtgtttctgatttgctggaattagctgtcctattaaaagaa
gttggtctagtagatgtcgataaggcccgtgttcagattgttccactttttgagacaatc
gaggacttagataatgcacctgataccatgcgtcaatatctgcaattagatttagcgaaa
cgttggattgcaggcaataaatactaccaagaaatcatgcttggctactcagattccaac
aaggatggtggctacctatcctccggctggacactctacaaagcacagaatgaattgacg
caaattggtcaagactacggagtaaacatcaccttcttccacggtcgtggtggtactgtt
ggtcgtggtgggggtccttcctatgatgcgattacatctcagccatttggttccatcaag
gaccggcttcgtttgacagaacaaggcgaagtgataggtaataaatacggtaacaaagac
gcagcctactataatttagaaatgctggtatctgcaacgcttgaccgtatggtcacacaa
atgattaccgatccaaatgaaatcgatggctatcgcgaaaccatggatgaaattgtatca
gatagctatcgtatttatagagatcttgtgttcaataatccacatttttatgattatttc
tttgccgctagtccaattcgtgaagtatcaagtctgaacattggctcacgtccagcggct
cgaaaaaccatcacagaaatcggtggtttgcgtgcgattccatgggtattctcttggtca
caaaaccgtgtcatgttgccaggttggtatggagttggttcaagtttcaaacgctttatt
gataagcaccctgataatttgtctaagttacaaaaaatgtacgaatcttggccattcttc
cgttcacttctatcaaacgtggatatggtattgtctaaatccaatatgaatatcgcattt
gaatatgctaaaatgtgtgaaagcgaagaggtacgaaatatcttccatgtcattttagat
gaatggcagttgaccaaagaaattattttgtcaatcgagcaaaatgatgagcttttagca
gaactaccgtttctaaaagctagtcttgactatcgcatgccttatttcaatgtgctcaac
tatattcagattgaattaattcatcgtcttcgtcgtggagaattgagcaaagaacaagag
aatctcattcatattaccatcaatggtgtggcgacaggtttgcgcaactcaggttaa

DBGET integrated database retrieval system