KEGG   Streptococcus suis 98HAH33 (serotype 2): SSU98_0845Help
Entry
SSU98_0845        CDS       T00515                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ssv  Streptococcus suis 98HAH33 (serotype 2)
Pathway
ssv00240  Pyrimidine metabolism
ssv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSU98_0845
Enzymes [BR:ssv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SSU98_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_30 AAA_22 ATPase_2
Motif
Other DBs
NCBI-ProteinID: ABP92003
LinkDB All DBs
Position
820899..821480
Genome map
AA seq 193 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDAFGVVSSRIGMRRDAV
AIDDDMDIFGFIEKMEPRPYCVLIDEAQFLRRHHVYALARVVDELDVPVMAFGLKNDFRN
ELFEGSQHLLLLADKLDEIKTICQYCSKKATMVLRTQDGKPTYEGEQIQIGGNETYIPVC
RKHYFSPEIKDLP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaattatattataaatatgggacaatgaactcaggaaaaaccattgagattttg
aaggttgcccacaactatgaagaacaaggaaaacctgttgttatcatgacatctgcactt
gatactcgtgatgcctttggtgttgtatccagtcgtataggcatgagaagagatgcagtg
gcgattgacgatgatatggatatctttggttttattgaaaaaatggaaccgcgtccttac
tgtgttctcattgatgaagcacaatttcttcgacgtcatcacgtctacgcacttgctcgc
gtagtcgatgaattagatgtacccgttatggctttcggtcttaaaaatgatttccgaaat
gaactatttgaaggttcccaacatttgctcttattggctgataaattagatgaaatcaaa
acaatctgccaatattgttctaaaaaagcgacaatggttttgagaacacaggatggaaaa
cctacttatgaaggagaacaaatccaaattggtggcaatgaaacctacattcctgtctgt
cgcaaacattatttttcaccagaaattaaagatttaccctaa

DBGET integrated database retrieval system