KEGG   Streptococcus suis 98HAH33 (serotype 2): SSU98_2062Help
Entry
SSU98_2062        CDS       T00515                                 

Definition
(GenBank) Putative L-xylulose-5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
ssv  Streptococcus suis 98HAH33 (serotype 2)
Pathway
ssv00040  Pentose and glucuronate interconversions
ssv00053  Ascorbate and aldarate metabolism
ssv01100  Metabolic pathways
ssv01120  Microbial metabolism in diverse environments
Module
ssv_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:ssv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSU98_2062
   00053 Ascorbate and aldarate metabolism
    SSU98_2062
Enzymes [BR:ssv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     SSU98_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Radical_SAM FTCD_N CBM_26 ComA
Motif
Other DBs
NCBI-ProteinID: ABP93220
LinkDB All DBs
Position
complement(1957962..1958825)
Genome map
AA seq 287 aa AA seqDB search
MARPIGIYEKATPKHFTWKERLEFAKELGFDFVEMSVDESDARLARLEWTKEERLDLVKA
IYETGVRIPTICFSGHRRYPLGSNDPALEAKSLETMKQCIELAQDLGVRVIQLAGYDVYY
EEKSPETRERFIKNLRQACDWAEQAQVMLGIEIMDDPFINSIEKYLAVEKEIDSPYLFVY
PDTGNVSAWHNDIYSEFYLGHRSIAALHLKDTYAVTENSKGQFRDVPFGQGCVDWDNMFA
VLKKTNYQGPFLIEMWSENCETVEETRAAIKEAQDFLYPLIEKAGLN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaccaatcggaatatatgaaaaggcaacgcccaaacacttcacatggaaggaa
cgtttggagtttgccaaagaattaggtttcgactttgtggaaatgtcggtagatgagagc
gatgcacgcttggctcgtttggaatggaccaaggaagagcgtttagacttggtcaaggcc
atctatgaaacaggtgtccgcattccgaccatttgtttctcaggtcaccgtcgctacccg
cttggctccaatgaccctgctcttgaagccaagtccttagaaaccatgaaacagtgtatc
gaactggctcaggatttgggcgttcgtgtcatccagttggctggctacgacgtttactac
gaggaaaaatcacctgaaactagagagcgtttcatcaagaatctccgtcaggcttgcgac
tgggcagaacaggctcaggtcatgttgggcattgaaattatggatgatccatttatcaac
tcaattgaaaaatacctagccgttgaaaaagaaatcgactcgccttatctctttgtctat
ccagatactggaaacgtgtctgcttggcataatgacatttacagcgaattttacctggga
caccgttctatcgcagcccttcacctcaaggatacctatgcggtaaccgaaaactccaag
ggtcaattccgtgatgtcccatttggtcagggctgtgtggactgggacaatatgtttgca
gtcttgaaaaagaccaactaccaaggtccattcttgattgagatgtggtctgaaaactgc
gaaacggttgaggaaacacgagcagctatcaaggaggcacaagatttcctctatccattg
attgagaaagcggggttaaactaa

DBGET integrated database retrieval system