KEGG   Streptococcus suis GZ1 (serotype 2): SSGZ1_0521Help
Entry
SSGZ1_0521        CDS       T02023                                 

Definition
(GenBank) Protein Translation Elongation Factor Tu
  KO
K02358  elongation factor Tu
Organism
ssw  Streptococcus suis GZ1 (serotype 2)
Brite
KEGG Orthology (KO) [BR:ssw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ssw03012]
    SSGZ1_0521
   03029 Mitochondrial biogenesis [BR:ssw03029]
    SSGZ1_0521
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssw04147]
    SSGZ1_0521
Translation factors [BR:ssw03012]
 Eukaryotic Type
  Elongation factors
   SSGZ1_0521
 Prokaryotic Type
   SSGZ1_0521
Mitochondrial biogenesis [BR:ssw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SSGZ1_0521
Exosome [BR:ssw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SSGZ1_0521
  Exosomal proteins of breast cancer cells
   SSGZ1_0521
  Exosomal proteins of colorectal cancer cells
   SSGZ1_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: ADE30986
UniProt: D5AGM1
LinkDB All DBs
Position
562408..563622
Genome map
AA seq 404 aa AA seqDB search
MEAFTKMAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASID
AAPEERERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDG
PMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVI
QGSALKALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGR
IDRGTVRVNDEIEIVGLQEEKSKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERG
QVISKPGSINPHTKFKGEVYILTKEEGGRHTPFFDNYRPQFYFRTTDVTGSIKLPEGTEM
VMPGDNVTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttggaggcttttaccaaaatggcaaaagaaaaatacgatcgtagtaaaccacacgttaac
attggtacaattggacacgttgaccacggtaaaactactttgacagcagctatcacaact
gtattggcacgtcgcttgccttcatcagttaaccaacctaaagactatgcgtctatcgat
gctgctccagaagagcgcgagcgcggtatcactatcaacactgcacacgttgagtacgaa
actgaaaaacgtcactatgctcacatcgacgctccaggacacgcggactacgttaaaaac
atgatcactggtgctgctcagatggacggtgcgatccttgtagtagcttcaactgacggt
ccaatgccacaaactcgtgagcacatccttctttcacgtcaggttggtgttaaacacctt
atcgtcttcatgaacaaagttgacttggttgacgatgaagaattgcttgagttggttgaa
atggaaatccgtgaccttctttcagaatacgatttcccaggtgatgatcttccagttatc
caaggttcagctcttaaagctcttgaaggtgactctaagtacgaagacatcgttatggaa
ttgatgaacactgttgatgagtacattccagaaccagaacgcgacactgacaaaccattg
ttgcttccagtcgaggacgtattctcaatcactggtcgtggtactgtagcttcaggacgt
atcgaccgtggtactgttcgtgtcaacgacgaaatcgaaatcgttggtcttcaagaagaa
aaatctaaagcagttgttactggtgttgaaatgttccgtaaacaacttgacgaaggtctt
gccggcgataacgttggtgtgcttcttcgtggtgtacaacgtgatgaaatcgaacgtggt
caagttatctctaaaccaggttctatcaacccacacactaaattcaaaggtgaagtttac
atccttactaaagaagaaggtggacgtcacactccattcttcgacaactaccgtccacag
ttctacttccgtacaactgacgtaactggttcaatcaaattgccagaaggtactgaaatg
gtaatgcctggtgataacgttactatcgacgttgaattgatccacccaatcgccgttgaa
caaggtactactttctctatccgtgaaggtggacgtactgttggttcaggtatggttaca
gaaatcgaagcttaa

DBGET integrated database retrieval system