KEGG   Streptococcus suis GZ1 (serotype 2): SSGZ1_1200Help
Entry
SSGZ1_1200        CDS       T02023                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssw  Streptococcus suis GZ1 (serotype 2)
Pathway
ssw00473  D-Alanine metabolism
ssw00550  Peptidoglycan biosynthesis
ssw01100  Metabolic pathways
ssw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSGZ1_1200
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSGZ1_1200
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SSGZ1_1200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssw01011]
    SSGZ1_1200
Enzymes [BR:ssw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSGZ1_1200
Peptidoglycan biosynthesis and degradation proteins [BR:ssw01011]
 Precursor biosynthesis
  Amino acid ligase
   SSGZ1_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ADE31657
UniProt: D5AIJ2
LinkDB All DBs
Position
complement(1241681..1242706)
Genome map
AA seq 341 aa AA seqDB search
MLNYAILRVIALIQEGKYMSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYF
ISQTGDFIKTQEFSQTPSADEKLMTNATIVEEQKIRPSDIYEEKAVVFPVLHGPMGEDGS
IQGFLEVLRMPYVGTNILSSSVAMDKITTKRVLESAGISQVPYVAVIEGENIDDKIAEIE
GKLTYPVFVKPANMGSSVGISKAEDLAGLRKALDLAFKYDSRVLVEQGVNAREIEVGLLG
NADVKTTLPGEVVKDVAFYDYDAKYIDNKITMEIPAKIDESIMDIMRDNAAKAFRAIGGC
GLSRCDFFPLFSLLSKKMVSYCFLVASIYTDCLPLYLVYRS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaattatgctatactaagagtaatagcgttgatacaggaaggaaaatatatgtca
aaagaaaccttgattttactatatggtgggcgttctgcagagcgtgaggtatctgttctg
tctgccgaaagcgtcatgcgtgctatcaattatgataaattttttgtcaaaacctatttc
attagccagaccggggactttattaagacgcaagagttttctcaaacaccgtctgccgat
gaaaaactcatgacaaacgcgacgattgttgaagagcaaaaaatccgtccgagcgatatt
tatgaagaaaaggcggttgttttccctgttcttcatggcccaatgggagaagacggatct
attcaaggcttcttggaagtgcttcgtatgccttatgttggcactaatatcttgtcttca
agcgttgctatggacaaaatcactaccaagcgcgtacttgaatcagcaggaatctcccag
gtaccttatgtggcagttatcgagggtgaaaatatcgacgataagattgcagagattgaa
ggaaaattgacttatccggtctttgtaaaaccagctaatatggggtcaagtgtcggtatc
tcaaaagctgaggatttagctggcttgcgtaaggcacttgatctggccttcaagtatgat
agccgtgtcctcgttgagcagggtgttaatgcgcgtgagattgaggtcggtcttttggga
aatgctgacgtgaaaacgacacttcctggcgaagtagtcaaagacgttgctttttatgac
tacgatgccaaatacatcgacaacaaaatcaccatggaaatcccagctaagattgatgag
tctatcatggatatcatgcgtgataatgctgccaaggccttccgtgctatcggtggttgt
ggactttctcgctgtgatttcttccctttgttttcgttgttatcaaaaaagatggtttca
tattgttttttggtggcttcaatttatacagattgtctccctttatacttggtatatcgt
agctga

DBGET integrated database retrieval system