KEGG   Streptomyces sp. SirexAA-E: SACTE_0397Help
Entry
SACTE_0397        CDS       T01601                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C PglD_N
Motif
Other DBs
NCBI-ProteinID: AEN08339
UniProt: G2NDA9
LinkDB All DBs
Position
complement(449160..450149)
Genome map
AA seq 329 aa AA seqDB search
MRAAIVEAPGKVSVTTVADPTPGPREVVVSVASCGLCGTDLHILQGEFAPTLPIVPGHEF
AGEIVGIGRDVTELAVGDRVAVDPSLHCHECRYCRIGRGNLCERWAAIGVTVAGGAAEFA
VAPVANCVKLPEHIDVKDAALIEPLSCAVRGYDVLSSTLGAEVLIYGSGTMGLMMLELAK
RTGAASVDVLDVNPDRLGTAGLLGCSRSAAGAEELEQPGGWDVVIDATGNAAAIQDGLGR
VAKGGTFLQFGVADYATTAVIEPYRIYNQEITITGSMAVLHSYERAAALFATGVLDPSVF
ISDRLPLEQYPQAIDRFKAGIGRKIVVQP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcagcgatcgtcgaagcccccggcaaggtctccgtcaccaccgtcgcggacccc
acccccggcccccgcgaggtcgtggtgtccgtcgcctcctgcgggctgtgcggtaccgat
ctgcacatcctgcagggtgagttcgcccccaccctgcccatcgtcccggggcacgagttc
gccggcgagatcgtgggcatcggccgtgacgtcacggagctggccgtcggcgaccgggtc
gccgtcgatccgtccctgcactgccacgagtgccgctactgccgcatcgggcggggcaac
ctctgcgagcgctgggccgccatcggcgtcaccgtcgccggcggcgccgcggagttcgcc
gtggcgcccgtcgccaactgcgtcaaactgcccgagcacatcgacgtcaaggacgccgcg
ctcatcgagccgctgtcctgcgcggtgcggggctacgacgtcctcagcagcaccctcggc
gccgaggtgctgatctacggctccggcacgatgggcctcatgatgctggagctcgccaag
cgcaccggcgcggcctccgtggacgtgctggacgtcaaccccgaccgcctcggcaccgcg
ggcctcctcggctgctcccggtcggcggcgggcgccgaggagctggagcagcccggcggc
tgggacgtcgtcatcgacgcgaccggcaacgcggccgccatccaggacggcctgggccgt
gtcgccaagggcggcaccttcctccagttcggggtcgccgactacgcgacgaccgcggtc
atcgagccgtaccgcatctacaaccaggagatcaccatcaccggctcgatggcggtgctg
cacagctacgaacgcgccgccgcgctcttcgccaccggtgtgctcgacccgtcggtgttc
atcagcgaccggctgccgctggagcagtacccgcaggccatcgaccgcttcaaggcgggc
atcgggcgcaagatcgtggtccagccgtga

DBGET integrated database retrieval system