KEGG   Streptomyces sp. SirexAA-E: SACTE_1402Help
Entry
SACTE_1402        CDS       T01601                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00220  Arginine biosynthesis
ssx00250  Alanine, aspartate and glutamate metabolism
ssx00290  Valine, leucine and isoleucine biosynthesis
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01130  Biosynthesis of antibiotics
ssx01210  2-Oxocarboxylic acid metabolism
ssx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SACTE_1402
   00290 Valine, leucine and isoleucine biosynthesis
    SACTE_1402
   00220 Arginine biosynthesis
    SACTE_1402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssx01007]
    SACTE_1402
Enzymes [BR:ssx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SACTE_1402
    2.6.1.66  valine---pyruvate transaminase
     SACTE_1402
Amino acid related enzymes [BR:ssx01007]
 Aminotransferase (transaminase)
  Class I
   SACTE_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Alliinase_C Beta_elim_lyase Death_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEN09320
UniProt: G2NAR9
LinkDB All DBs
Position
1562748..1563959
Genome map
AA seq 403 aa AA seqDB search
MEFRQSSKLNEVCYEIRGPVIEQANALEEAGHSVLRLNTGNPALFGFEAPEEIVQDMIRM
LPQAHGYTDSRGILSARRAVAQRYQAMGLADVDVDDVFLGNGVSELISMAVQALLEDGDE
VLIPSPDYPLWTAVTTLAGGKAVHYTCDESADWNPDLADMASKITDRTRAVVIINPNNPT
GAVYPREVLDGILDLARRHGLMVFADEIYDQILYDDAEHHPVSVLAPDLLCLTFSGLSKT
YRVAGFRSGWMVVSGPQQHARNYLEGLTTLASMRLCPNAPAQYAIQAALGGRQSIRELVA
PGGRLHEQRDRAWERLNEIPGVSCVKPKGALYAFPRIDPKVHAIVDDERFVLDLLLREKI
QVVQGTGFNWPRPDHFRILTLPYADDLDAAISRIGRFLNGYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagttccgtcagtccagcaagctcaacgaggtctgttacgagatcaggggtccggtc
atcgagcaggccaacgcgctcgaggaggccggccacagcgtgctccgcctgaacacgggc
aatccggcgctcttcggcttcgaggctcccgaggagatcgtccaggacatgatccggatg
ctcccccaggcacacggctacaccgactcgcgcggcatcctgtccgcccgccgcgccgtg
gcacagcggtaccaggcgatggggctggccgacgtcgacgtggacgacgtcttcctgggc
aacggcgtctccgagctgatctccatggccgtacaggcgcttctggaagacggcgacgag
gtgctgatcccgagccccgactacccgctgtggaccgccgtgaccacgctcgcgggcggc
aaggccgtgcactacacctgcgacgagtcggccgactggaacccggacctcgccgacatg
gcctcgaagatcaccgaccgcacccgggccgtggtcatcatcaaccccaacaacccgaca
ggcgccgtctacccccgggaggtcctcgacggcatcctcgacctggcgcgccgtcacggg
ctgatggtcttcgccgacgagatctacgaccagatcctgtacgacgacgccgagcaccac
ccggtgtcggtcctggcgccggatctgctctgcctcaccttcagcgggctgtccaagacg
taccgtgtcgccgggttccgttccgggtggatggtggtgtcgggcccgcagcagcacgcc
cgcaactatctggaggggctgaccacgctcgcctccatgcggctgtgccccaacgctccc
gcccagtacgcgatccaggccgcgctcggcggccggcagtcgatccgggagctcgtcgcc
ccgggcggcaggctccacgagcagcgtgaccgggcctgggagcggctgaacgagatcccc
ggggtgtcgtgcgtgaagccgaagggggcgctgtacgcgttcccccgcatcgacccgaag
gtgcacgccatcgtcgacgacgagcggttcgtcctggacctgctgctgcgggagaagatc
caggtggtgcagggcaccgggttcaactggccccggccggaccacttccggatcctgacc
ctgccgtacgccgacgacctcgacgcggcgatcagccgcatcggccgcttcctgaacgga
taccgccagtga

DBGET integrated database retrieval system