KEGG   Streptomyces sp. SirexAA-E: SACTE_1737Help
Entry
SACTE_1737        CDS       T01601                                 

Definition
(GenBank) alpha-L-glutamate ligase, RimK family
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00300  Lysine biosynthesis
ssx01100  Metabolic pathways
ssx01210  2-Oxocarboxylic acid metabolism
ssx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SACTE_1737
Enzymes [BR:ssx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     SACTE_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST R2K_3 ATP-grasp_3 CPSase_L_D2 ATP-grasp_5 ATP-grasp CP_ATPgrasp_2 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AEN09647
UniProt: G2NKG5
LinkDB All DBs
Position
1938762..1939625
Genome map
AA seq 287 aa AA seqDB search
MNSATLRLGVLASRVRFEEKCILAALERRGVACEQIDPRTLAVRAGAPWTGPRTVLNREV
GHYRALYAASALESTGARVLNTAAAAAVCGDKWQTSAALVARGVPTPDTSLALTPDAALA
ALEQFGYPAVIKPLVGSWGRLVTRVTGPAMAAAVLEHLAALPSPQSHIVYVQREVAKADR
DIRVLVVGGRAVGATYRRSDEWRTNVARGAVSERCPLDPGLTELAVAAAKTVGAHIAGVD
LLQDPDGRLTVLEVNDRVEFRGLQQSHGTDIDVADAVAALLIEEAQA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgcgacactgcggctcggcgttctcgcctcgcgcgtccgcttcgaggagaaa
tgcattctggcagcgctggagaggcgcggcgtcgcatgtgagcagatcgacccccgcacg
ctggcggtccgggccggagcgccttggaccggcccgcgcaccgtgctcaaccgggaggtc
ggccactaccgggcgctgtacgcggcgagcgcgctcgagtcgacgggggcgagggtgctc
aacaccgcggcggccgcggcggtgtgcggcgacaagtggcagacctccgcggcgctggtg
gcccgtggggtgccgacgcccgacaccagcctcgcgctgacccctgacgcggcgctggcg
gccctggagcagttcggctaccccgccgtgatcaagcccctcgtcggttcctggggccgc
ctggtgacccgggtcaccggcccggcgatggccgcggcagtcctggaacacctggcggcg
ctgccgtccccgcagtcacacatcgtctacgtccagcgcgaagtcgccaaggccgaccgg
gacatcagagtcctggtggtcggcggacgggccgtcggggcgacgtaccgcagaagcgac
gaatggcgcacgaacgtcgcccgcggggcggtcagcgagcgctgcccgctcgatcccggg
ctcacggagctggccgtggccgcggcaaagaccgtcggcgcgcacatcgcgggggtggat
ctgctccaggacccggacggccggctgacggtgctggaggtcaacgaccgggtggagttc
cgggggctccagcagagccacggtacggacatcgacgtggcggacgccgtcgccgccctg
ctgatcgaggaggcacaggcatga

DBGET integrated database retrieval system