KEGG   Streptomyces sp. SirexAA-E: SACTE_1899Help
Entry
SACTE_1899        CDS       T01601                                 

Definition
(GenBank) ABC transporter related protein
  KO
K10548  putative multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SACTE_1899
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssx02000]
    SACTE_1899
Transporters [BR:ssx02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter
    SACTE_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N ABC_ATPase AAA_29 AAA_23 RsgA_GTPase AAA_15 AAA_22 AAA_30 AAA_27 Rad17
Motif
Other DBs
NCBI-ProteinID: AEN09805
UniProt: G2NBW8
LinkDB All DBs
Position
2105833..2107383
Genome map
AA seq 516 aa AA seqDB search
MAGPVLEMRSIVKTFPGVKALSDVTLTVRQGEVHAICGENGAGKSTLMKVLSGVHPHGSY
EGDVLFEGETCRFKDIRASEQHGIVIIHQELALVPYLSVAENIFLGNEHAKRGMINWNDT
LRHAGELLRRVGLDEHPETRVADIGVGKQQLVEIAKALSKKVKLLILDEPTAALNDEDSG
KLLDLILSLKEQGITSIIISHKLNEIRRVADSVTIIRDGHSIETLDVKAPETTEDRIISG
MVGRDLENRFPERTPHHPEEGTAPALEIRNWTVHHPIDQQRKVVDDVSIEVRRGEIVGIA
GLMGAGRTELAMSVFGRSYGRYAGGTVLRDGTEIRTKSVPEAVGHGIAYATEDRKHYGLN
LIDTINRNISLTALGKVSKRGVVDEHGERQVAEGFRKSMNIKAPTVFEPVGKLSGGNQQK
VVLSKWIFAGPEVLILDEPTRGIDVGAKYEIYTVIDQLAAQGKAVVFISSELPELLGMCD
RIYTMAAGRLTGEFSRADASQEALMRQMTKDKEVTR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacccgtcctggaaatgcgctcgatcgtcaagaccttccccggtgtcaaagcg
ctctcggacgtcacactgacggtacgtcagggcgaggtccacgccatctgcggagagaac
ggtgccgggaagtcgaccctgatgaaggtgctctccggcgtccatccgcacggcagctac
gaaggggacgtcctcttcgagggcgagacctgccggttcaaggacatccgggcgagcgaa
cagcacggcatcgtgatcatccaccaggagctggcactggtgccgtacctgtccgtcgcg
gagaacatcttcctcggcaacgagcacgccaagcgcggaatgatcaactggaacgacacc
ctcaggcacgccggtgaactgctgcggcgggtcggcctggacgagcacccggagacccgc
gtcgccgacatcggcgtgggcaagcagcagttggtggagatcgccaaggcgctgtcgaag
aaggtgaagctgctcatcctcgacgagccgacggcggcgctcaacgacgaggacagcggc
aaactcctcgacctgatcctctcgttgaaggaacagggcatcacctcgatcatcatctcg
cacaagctgaacgagatccgcagggtcgccgactcggtcacgatcatccgcgacgggcac
tccatcgagacgctcgacgtgaaggcgccggagacgaccgaggaccggatcatcagcggg
atggtcggccgcgacctggagaaccgcttcccggagcggaccccgcaccatcccgaggag
ggcaccgcacccgccctggagatccgcaactggacggtgcaccaccccatcgaccagcag
cgcaaggtcgtcgacgacgtctcgatcgaggtgcggcgcggcgagatcgtcggtatcgcc
gggctcatgggcgccggccgcaccgagctggcgatgagcgtcttcggccgctcctacggc
cggtacgccggcggcaccgtcctcagggacggcaccgagatccgtacgaagtccgtcccg
gaggcggtggggcacggcatcgcgtacgccaccgaggaccgcaagcactacggcctcaac
ctcatcgacaccatcaaccggaacatctcgctgaccgcgctgggcaaggtctccaagcgg
ggtgtggtcgacgagcacggcgagcggcaggtcgccgagggcttccggaagtccatgaac
atcaaggcgccgaccgtcttcgagccggtgggcaagctgtccggcggcaaccagcagaag
gtcgtcctcagcaagtggatcttcgcgggtcccgaggtgctgatcctggacgagcccacg
cgcggcatcgacgtgggcgccaagtacgagatctacacggtcatcgaccaactggccgcc
cagggcaaggcggtcgtcttcatctcctccgagctgccggagctgctcggcatgtgcgac
cgcatctacacgatggccgcggggcgcctcacgggtgagttctcccgggccgatgcctcg
caggaagcgctgatgcgtcagatgacgaaggacaaagaggtaacccgatga

DBGET integrated database retrieval system