KEGG   Streptomyces sp. SirexAA-E: SACTE_2452Help
Entry
SACTE_2452        CDS       T01601                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AEN10340
UniProt: G2NKY5
LinkDB All DBs
Position
complement(2737980..2739767)
Genome map
AA seq 595 aa AA seqDB search
MGTPAGRRDTTGAKPQGVGSPLPAVHRVVRVGRNIRAGRGAAEHNDQQGAHDVRPVGSKY
LLEEPLGRGATGTVWRARQRETAGAEAAVAGQPGETVAIKVLKEELANDADIVMRFLRER
SVLLRLTHPNIVRTRDLVVEGDLLALVMDLIDGPDLHRYLRENGPLTPVAASLLTAQIAD
ALAASHADGVVHRDLKPANVLLDERDGEMHPMLTDFGIARLADSPGLTRTHEFVGTPAYV
APESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGGTALEVLHRHLSEEPGRPSNVPEPL
WTVIERCLRKDPDQRPSAVNLARALRTVGSGIGVHANSEQIAAAEGVGALLAPDPAPAAV
PDTPGAADPTQVLPSNAGSYDPAAPTSVMQTPGGGHADPTAVMPPVPPRPDGAPQPDEPH
PWQSQLRAARDRNEQTQVQYLDPSQDPLRRRPQRQQPPPQDQRPPQRQQQPPPQQYRPQP
QRAQQYPPQQAQQYQPQQQQYAPPQQPAPRPAPEPPAPRQPRQRSANPMHIPGLGCLKGC
LFTVVLLIVAGWLIWELTPLQGWIDEGKGYWEAIGDGISKVTGWFDDLGGSSGGR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacgcccgccgggcgccgggacaccacgggcgcgaagccgcagggcgtcgggagc
ccgctccccgccgtgcaccgggtcgttagagtgggccggaacatccgggcgggccggggg
gccgccgagcacaacgatcagcagggagcgcatgacgtgcggccggtaggcagcaagtac
ctgctcgaggagccgctcgggcgcggtgccacgggcaccgtctggcgagcccgccagcgt
gagaccgccggggccgaggcggccgtcgccggccagcccggcgagaccgtggcgatcaag
gtgctcaaggaggagctggccaacgacgcggacatcgtgatgcgcttcctgcgtgagcgc
tccgtgctgctgcggctcacccacccgaacatcgtgcgcacccgggacctcgtcgtcgag
ggcgacctgctcgccctggtgatggacctgatcgacggtcccgacctgcaccgctacctc
cgggagaacggtccgctcaccccggtcgccgcctccctgctcaccgcccagatcgcggac
gcgctcgccgccagtcacgccgacggcgtcgtccaccgcgacctgaagcccgccaacgtg
ctgctcgacgagcgcgacggcgagatgcacccgatgctcaccgacttcggcatcgcgcgg
ctggccgactccccgggactgacccggacccacgagttcgtcggcacgcccgcctacgtg
gcacccgagtccgccgagggccgtccgcagacctccgccgtggacatctacggcgcgggc
atcctgctgtacgaactggtcacgggccgcccgccgttcgcaggcggcaccgcgctggag
gtcctgcaccggcacctcagcgaggagcccggcaggccgagcaacgtccccgaaccgctg
tggacggtcatagagcgctgcctgcgcaaggaccccgaccagcggcccagcgccgtgaac
ctcgcccgggcgctgcgcaccgtcggttccggcatcggcgtgcacgccaactccgagcag
atcgcggccgccgagggggtgggcgccctgctggcccccgacccggcgcccgccgccgtc
cccgacaccccgggcgcggccgacccgacccaggtgctgccgagcaacgcgggctcgtac
gacccggcggccccgaccagcgtcatgcagaccccgggcggcgggcacgccgaccccacc
gctgtcatgcccccggtacccccgcgccccgacggggccccgcagcccgacgagccgcac
ccctggcagtcccagctgcgggcggcccgcgaccgcaacgagcagacgcaggtccagtac
ctcgacccgagccaggacccgctgcgccgccgcccgcagcgccagcagccgcccccgcag
gaccagcggcccccgcagcggcagcagcagcccccgccgcagcagtaccggccccagccg
cagcgcgcccagcagtacccgccgcagcaggcgcagcagtaccagccccagcagcagcag
tacgcgccgccgcagcagcccgccccacggccggcacccgagccgccggccccgcgtcag
ccccggcagcgcagcgccaacccgatgcacatccccggcctcgggtgtctcaagggatgc
ctgttcacggtggtgctgctgatcgtcgcgggctggctgatctgggagctgacacccctc
cagggctggatcgacgagggcaagggctactgggaggccatcggggacgggatctccaag
gtcaccggctggttcgacgacctcggcggctcctccggcggccggtaa

DBGET integrated database retrieval system