KEGG   Streptomyces sp. SirexAA-E: SACTE_4780Help
Entry
SACTE_4780        CDS       T01601                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00473  D-Alanine metabolism
ssx00550  Peptidoglycan biosynthesis
ssx01100  Metabolic pathways
ssx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SACTE_4780
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SACTE_4780
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SACTE_4780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssx01011]
    SACTE_4780
Enzymes [BR:ssx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SACTE_4780
Peptidoglycan biosynthesis and degradation proteins [BR:ssx01011]
 Precursor biosynthesis
  Amino acid ligase
   SACTE_4780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AEN12606
UniProt: G2NJ32
LinkDB All DBs
Position
5298082..5299287
Genome map
AA seq 401 aa AA seqDB search
MSSENLPQSPESPVGAGQSPASSGQSSEQRRKPRVAVVFGGRSSEHGISVVTAGAVMSAL
DRTKYDVLPIGITRDGRWALTADDPARMAISDRQVPDVDRLAQSAEGAVTLSVDPGNRDV
VVGEPGAVPTVLGEVDVVFPMLHGPYGEDGTLQGFLELSGVPYVGAGVLASAVGQDKEYM
KRVFTSFGLPVGPYEVVRPREWESDRPAARKRIMEFAAEHGWPLFVKPARGGSSMGITKV
DDPSGLDEAIEEARRHDPKFLVESLLRGREIECGVLEFEDGPRASVPAEIPPVTAHDFYD
FEAKYIDSAAGLVPAPLTEEQTAEVRRLAVDAFEAASCEGLVRADFFLTEDGTFVINEIN
TMPGFTPISMYPRMWQESGVSYPELVDRLIQAALNRSTGLR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgagaacctcccccagagccctgagagccccgtcggagccggacagagcccc
gcgagctccggacagagctccgaacagcgccgcaagccgcgcgtggccgtcgtgttcggc
ggccggagctccgaacacggcatctcggtcgtcacggccggcgccgtgatgagcgccctc
gaccggaccaagtacgacgtcctgccgatcggcatcacccgggacggacgatgggccctg
acggccgacgacccggcccgcatggccatctccgaccggcaggtccccgacgtggaccgg
ctcgctcagtccgcggagggggccgtgacgctgtccgtcgaccccggcaaccgcgacgtc
gtcgtcggcgaacccggcgcggtgcccacggtgctgggcgaggtcgacgtcgtcttcccc
atgctgcacgggccctacggcgaggacggcaccctccagggattcctggagctctccggc
gtcccctacgtcggcgccggggtcctggcctcggccgtgggccaggacaaggagtacatg
aagcgggtgttcacctccttcgggctgccggtcggcccgtacgaggtcgtccgcccccgc
gagtgggagtcggaccgccccgccgcccgcaagcgcatcatggagttcgccgccgaacac
ggctggccgctcttcgtcaagcccgcccgcggcggctcgtccatgggcatcaccaaggtc
gacgacccctccggcctggacgaggcgatcgaggaggcccgccgccacgaccccaagttc
ctggtggagtcgctgctgcggggccgggagatcgagtgcggcgtgctggagttcgaggac
ggcccgcgcgccagcgtgcccgccgagatcccgccggtcaccgcgcacgacttctacgac
ttcgaggccaagtacatcgactcggcggccggactggtccccgcgccgctcaccgaggag
cagaccgccgaggtgcgccggctcgccgtcgacgccttcgaggccgcctcctgcgaaggc
ctggtgcgcgccgacttcttcctcaccgaggacggcacgttcgtcatcaacgagatcaac
acgatgcccgggttcaccccgatctccatgtacccgcggatgtggcaggagagcggcgtc
agctacccggagctggtggaccggctgatccaggcggcgctgaaccgctccaccggactg
cgctga

DBGET integrated database retrieval system