KEGG   Streptomyces sp. SirexAA-E: SACTE_5195
Entry
SACTE_5195        CDS       T01601                                 

Definition
(GenBank) Polyketide cyclase/dehydrase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx01056  Biosynthesis of type II polyketide backbone
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
Module
ssx_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SACTE_5195
Enzymes [BR:ssx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     SACTE_5195
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: AEN13013
UniProt: G2NJD9
LinkDB
Position
5854023..5854964
AA seq 313 aa
MSSTQRRVEHGITIDADVETVFDLVADVARWPQFHLSAVHAETVHANEKGELVKYWALDG
DAAVRTWQTVRRTDRPGRRITFAHMEARPPATELRGEWVFTELAPDRTRVELSHQVGAPA
DADLGPLLDGLAQDSEDCLTTLRDTAERHADLDELVVSFTDPLFIAGSVEDAYDYLYRAD
LWPERIPHVVGLAMTEDEPNVQFFDMDTKGPDGSTHTVRSVRICLPSRLIVYKQISLPAM
LDAHTGHWRFTETPEGVVAEARHTSTIKRSALSQLGGATTVGEARRYLRRLLSGNSMSNL
RLAKAYAEERAGF
NT seq 942 nt   +upstreamnt  +downstreamnt
gtgtcgagtacacagcggcgagtcgagcacggcatcaccatcgacgccgatgtcgagacg
gtgttcgacctggtcgcggacgtagcacgatggccgcagttccacctgtccgcggtgcac
gcggagacggtccacgccaacgagaagggggaactggtcaagtactgggctctggacgga
gacgccgccgtccgcacctggcagaccgtgcgccgcacggaccggccgggacgccgtatc
accttcgcccacatggaggcccgaccgcccgccaccgaactccgcggcgagtgggtcttc
accgaactggctccggaccggacccgggtcgagctgtcccaccaggtcggcgcgccggcc
gacgccgatctcggaccgttgctggacgggctcgcccaggacagcgaggactgcctgacc
acgctgcgcgacacggcggagcgccatgccgacctggacgaactcgtcgtgtccttcacc
gacccgttgttcatcgccggctccgtcgaagacgcctacgactacctctaccgggcggac
ctgtggccggagcgcattccgcacgtggtgggactcgccatgaccgaggacgagccgaac
gtccagttcttcgacatggacaccaagggcccggacggcagcacgcacaccgtccgttcg
gtgcggatctgcctcccgtcccgactgatcgtgtacaagcagatctcactgcccgcgatg
ctggacgcgcacaccggccactggcggttcaccgagacgccggaaggcgtcgtcgccgag
gcgcggcacaccagcacgatcaagcggtcggcgctgtcccagctgggcggcgcgacgacg
gtcggtgaggcccgccggtacctgcggcgtctgctgagcggcaacagcatgagcaacctg
cgcctcgccaaggcgtacgcggaggagcgcgccggtttctga

DBGET integrated database retrieval system