KEGG   Sphingobium sp. SYK-6: SLG_05640Help
Entry
SLG_05640         CDS       T01622                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ssy  Sphingobium sp. SYK-6
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SLG_05640 (ahpF)
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SLG_05640 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 DAO NAD_binding_7 Thi4 K_oxygenase Glutaredoxin NAD_binding_8 FMO-like Thioredoxin_4 baeRF_family10 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: BAK65239
NITE: SLG_05640
UniProt: G2ILH6
LinkDB All DBs
Position
586843..588426
Genome map
AA seq 527 aa AA seqDB search
MLDAAIKTQLQAYMANIKLPIELVPSLDGGAKSAELRDLLHEIEGLSPLVTLAADEGDAR
KPSFLIRRTGTDISVRFAGIPLGHEFTSLVLALLQVGGHPPKVDDDVIAQVKALEGDFVF
ETYFSLSCQNCPDVVQALNLMSVLNPRIRHTAIDGGLFKAEVDARKVMAVPTVYLNGEVF
ASGRMDIEQIIAKLDTGATARAAEKIAAKEPFDVLVVGGGPAGAAAAIYAARKGIRTGIV
AERFGGQVLDTMAIENFISVPHTEGPKLAAALEQHVKDYDVDIMNVQKAKKLVPAKTPGG
YAEVQLESGASLKAKAVILSTGARWRQMNVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLYSLPNVSVITSAQTTEVHGDG
EKVIGLTYKDRNSGQSHLLELEGIFVQIGLVPNTEFLVDTVGLSSRGEIEVDARAHTSQQ
GIFAAGDCTTVPYKQIVIAMGQGSTAALSAFDYLIRLAPADEQAKAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccgcgatcaagacccagctgcaggcctatatggccaacatcaagctgccg
atcgagctggtgccctcgctcgacggcggcgccaaatcggccgagctgcgcgacctgctc
cacgaaatcgaagggctgagccccctcgtcacgctggcagcggacgaaggcgatgcgcgc
aagcccagcttcctcatccgccgcacgggcacggacatcagcgtgcgcttcgccggcatt
cccctcggccacgagttcacctcgctggtgcttgccctgctgcaggtcggcggccatccg
cccaaggtggacgatgacgtgatcgcgcaagtgaaggcgctggagggcgacttcgtcttc
gagacctatttctcgctctcctgccagaactgcccggacgtggtgcaggcgctgaacctg
atgagcgtgctcaatccgcgcatccgccacaccgcgatcgacggcggcctgttcaaggcc
gaagtggacgcgcgcaaggtgatggccgtgccgaccgtctatctcaacggcgaggtgttc
gcgtccggccgcatggacatcgagcagatcatcgccaagctggacaccggcgcgaccgcc
cgcgcggccgagaagatcgccgccaaggagccgttcgacgtgctcgtggtgggcggcgga
ccggccggtgcggccgcggcgatctatgccgcgcgcaagggcatccgcaccggcatcgtc
gccgagcgcttcggcgggcaggtgctcgacaccatggccatcgagaacttcatttccgtg
ccccacacggaagggcccaagctcgctgccgcactggagcagcacgtcaaggattatgac
gtggacatcatgaacgtgcagaaggcgaagaagctcgtgccggcgaagacgcccggcggc
tatgccgaagtgcagctcgagagcggcgcctcgctgaaggccaaggccgtgatcctctcc
accggcgcgcgctggcggcagatgaatgtgccgggcgaggacgagtatcgcaacaagggc
gtcgcttattgcccgcactgcgatggcccgctgttcaagggcaagcgcgtcgccgtgatc
ggcgggggcaatagcggtgtggaagcggcgatcgatctggcgggcatcgtggcgcatgtc
acgctgatcgagttcgacagccagctgcgcgccgacgcagtgctccagcgcaagctctac
agcctgcccaacgtctccgtcatcacctcggcccagacgaccgaagtacatggcgacggc
gagaaggtgatcggcctgacctacaaggatcgcaacagcgggcagtcccatctgctggag
ctggaaggtatcttcgtgcagatcgggctcgtgccgaacacggagttcctggtcgacacg
gtcggcctctccagccgcggcgagatcgaggtcgacgcgcgggcgcatacgtcccagcag
ggcatcttcgcggccggcgactgcaccaccgtgccctacaagcagatcgtcatcgccatg
gggcagggttccaccgccgccctctcggccttcgactatctcatccggctcgcgcctgcc
gacgagcaggcgaaggcggcataa

DBGET integrated database retrieval system