KEGG   Sphingobium sp. SYK-6: SLG_05970Help
Entry
SLG_05970         CDS       T01622                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00473  D-Alanine metabolism
ssy00550  Peptidoglycan biosynthesis
ssy01100  Metabolic pathways
ssy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SLG_05970 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SLG_05970 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SLG_05970 (ddlA)
Enzymes [BR:ssy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SLG_05970 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ssy01011]
 Precursor biosynthesis
  Amino acid ligase
   SLG_05970 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAK65272
NITE: SLG_05970
UniProt: G2IM17
LinkDB All DBs
Position
619943..620914
Genome map
AA seq 323 aa AA seqDB search
MSGPWKVAVLMGGWSAEREVSLSSGAGIVKALEERGHSAIPIDLGASPAEGRDLPAKLIA
ADPDIVFNALHGVPGEDGTVQGLMDIMGYRYTHSGLATSVIAIDKQLTKQHLVPHGIPMP
GGHIVASEDLFAADPLPRPYVVKPVNEGSSVGVAIVTAEGNYGNPIGRDVKGPWQEFDEL
LAEPFIRGRELTVAVLGDRALAVTELKPRSGFYDYDAKYTDGMTEHVCPADVPVDIAQAM
MDIALRAHRLLGCKGTSRSDFRWDDEQGVEGLFLLEVNTQPGMTPLSLVPEQARHLGMSY
GALVEAIIADALAEGTPAKGAKE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtccctggaaagtcgcggtgctgatgggcggctggtccgccgagcgggaggtg
tcgctgagcagcggcgcgggcatcgtcaaggcgctggaagagcgcgggcacagcgcaatt
cccatcgatctgggtgcgagcccggcggaagggcgcgacttgcccgccaagctgatcgcc
gccgatcccgacatcgtgttcaacgcgctgcacggcgtgccgggcgaggacgggacggtg
caggggctcatggacatcatgggctatcgctacacccatagcggccttgccacctcggtc
atcgcgatcgacaagcaactcaccaagcagcatctggtgccgcacggcatccccatgccc
ggcgggcacatcgtggcgagcgaggatctgttcgccgccgatccgctgccgcggccttat
gtggtgaaaccggtcaacgaagggtcatcggtcggtgtcgccatcgtcactgccgaaggc
aattacggcaatcccatcggtcgggacgtgaaggggccgtggcaggaattcgacgagctg
ctggccgagccgttcatcagggggcgcgagctgaccgtcgcggtgctcggcgatcgggcg
ctcgcggtgacggaactgaagcccaggagcggcttctacgattatgacgcgaaatatacc
gacggcatgaccgagcatgtctgcccggccgacgtgccggtggacatcgcgcaggcgatg
atggacatcgcgctgcgcgcgcaccggctcctcggctgcaagggcacgtcccgctccgat
tttcgctgggatgacgagcagggcgtcgagggcctcttcctgctggaagtgaacacccag
cccggcatgacgccgctcagcctcgtgcccgagcaggcgcggcatctcggcatgagctac
ggcgcgctcgtggaagcgatcattgcggacgcgctggcggaaggcacgccggcgaaggga
gcgaaggaatga

DBGET integrated database retrieval system