KEGG   Sphingobium sp. SYK-6: SLG_17770Help
Entry
SLG_17770         CDS       T01622                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01130  Biosynthesis of antibiotics
ssy01230  Biosynthesis of amino acids
Module
ssy_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SLG_17770 (aroK)
Enzymes [BR:ssy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SLG_17770 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 AAA_17 CoaE AAA_22 AAA_16 dNK AAA AAA_5 Cytidylate_kin AAA_28 ETF Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: BAK66452
NITE: SLG_17770
UniProt: G2ISU2
LinkDB All DBs
Position
complement(1949273..1949812)
Genome map
AA seq 179 aa AA seqDB search
MVRNDKYEDRRPQTSLVLVGLMGVGKSTIGRRLAARLGLPFVDADDEIERAAGMSIQEIF
DTFGEAQFRDGERRVIARLIDGTPKVIATGGGAFVNEDTRRLILEKAVAIWLDANIDILV
ERVSRRDGRPLLRNRNAREVLTQLADERRPFYSQAPIRVMSSDSPHDATIDKIMKAIGQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgaaacgataaatatgaggatcggcggccgcagacctctctcgtcctcgtagga
ctgatgggcgtgggcaagtcgaccatcggccgtcggctggccgcgcgccttgggctgccc
ttcgtcgatgcggacgatgaaatcgaacgcgccgccggaatgagcatccaggaaatcttc
gacaccttcggcgaagcgcagttccgcgacggcgagcggcgcgtgatcgcgcggctgatc
gatggcacgcccaaggtgatcgcgaccgggggcggcgcgttcgtcaacgaggacacgcgc
aggctcatcctggaaaaggccgtcgcgatctggctcgatgccaatatcgacattctggtc
gagcgcgtctctcgccgcgatggccggccgctgctccggaaccgcaacgcccgcgaagtg
ctcacccagctggcggatgagcggcgccccttctattcccaggcgccgatccgcgtgatg
agctcggattcgccgcatgacgcgaccatagacaagatcatgaaggcgatcggccaatga

DBGET integrated database retrieval system