KEGG   Sphingobium sp. SYK-6: SLG_22450Help
Entry
SLG_22450         CDS       T01622                                 

Gene name
topA
Definition
(GenBank) DNA topoisomerase I
  KO
K03168  DNA topoisomerase I [EC:5.6.2.1]
Organism
ssy  Sphingobium sp. SYK-6
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssy03032]
    SLG_22450 (topA)
   03400 DNA repair and recombination proteins [BR:ssy03400]
    SLG_22450 (topA)
Enzymes [BR:ssy01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     SLG_22450 (topA)
DNA replication proteins [BR:ssy03032]
 Prokaryotic type
  DNA Topoisomerases
   SLG_22450 (topA)
DNA repair and recombination proteins [BR:ssy03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      SLG_22450 (topA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Topoisom_bac Toprim_C_rpt Toprim zf-C4_Topoisom Toprim_4
Motif
Other DBs
NCBI-ProteinID: BAK66920
NITE: SLG_22450
UniProt: G2IHZ7
LinkDB All DBs
Position
complement(2424711..2427314)
Genome map
AA seq 867 aa AA seqDB search
MKLVIVESPAKAKTIEKYLGGDYRVLASYGHVRDLPPKDGSVDPEHGFAMAWENYGDKAR
QLKAITDEAKKADELILATDPDREGEAISWHVQEVLRAKKALPERVERVTFNAITKATIT
EAMKHPRALDDDLIDAYRARRALDYLVGFTLSPVLWRKLPGAKSAGRVQSVALRLIVERE
REIEAFVSQEYWSVTALLEQGGQRFDARLVRWRGEKLDRLSIGKEGDALAAKADVEAGRF
TVSSVETKPATRNPPPPFTTSTLQQEAARKLGLSASETMRVAQQLYEDGAITYMRTDGVQ
MDESAISAARNAIAKRYDGGYLPDKPRHYQTKAKNAQEAHEAIRPTDFSRESAGSGVHAK
LYDLIFKRALASQMASARLERTAVELTDGTGQHVLRATGQVVLFPGFLALYEEGRDDPVG
RQGAGDGEDEESRLLPALKAGDQPAKKDVRADQHFTQPPPRYSEASLVKRLEELGIGRPS
TYASTIQTLKDRDYVRIEKNRFFAEESGRLVTAFLERFFERYVSYDFTAGLEEELDEISG
GRAQWQQVLEAFWRDFKPKTAEIMEQKPSEITAALDEYLAPMLFPDKGDGSDPRLCPLCH
DGRLSLRGGRYGAFIACSNYPECRYTRKFGQPGGADGDAAGGNEELGTHPETGEPILRKS
GRFGPYVEMGSGKEAKRASIPKDLPNGELTLDWATRLLSLPRTIGDHPETGKPITASLGR
YGPYLAHDGKYARLASTAEIFETGMNAAVAKLADAANRGGARKAAEPLKILGAHPRTEAE
IRLMEGRYGPYVTDGTTNATLPKTVAPDALTLEEAAQLIDERAAKAPAGKRKGKAKSSAG
KSGAAKKTTVKGKAPSKAKSKAPAAAE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtcatcgtcgaatcgccggccaaggccaagaccatcgagaagtatctcggc
ggggattatcgcgtcctggcttcatatggccatgtgcgcgacctgccgcccaaggacggg
tcagtcgatccggagcatggctttgccatggcttgggaaaattatggcgacaaggcgcga
cagctcaaggccatcacggacgaggcgaagaaggccgacgaactcatcctggcgactgac
cctgaccgcgagggcgaggcgataagctggcacgtgcaggaagtcctgcgcgccaagaag
gccctgcccgagcgggtggagcgcgtgaccttcaacgcgatcaccaaggcgacgataacg
gaggcgatgaagcatccgcgcgcgctcgacgacgacctgatcgacgcctatcgcgcgcgg
cgtgcgctggactatctcgtgggtttcacgctttcgccggtgctctggcgcaagctgccg
ggcgccaagtccgccgggcgcgtgcaatccgtggcgctgcggctgatcgtggaacgcgag
cgggagatcgaggcgttcgtctcgcaggaatactggtccgtcacggcgcttctggagcag
ggcgggcagcgattcgatgcgcggctcgtgcgttggcgcggcgagaagctcgaccggctg
agcattggcaaggaaggcgacgcgcttgcagccaaggccgatgtggaggccgggcgcttc
acggtttcctctgtcgagaccaagcccgcaacgcgcaatccgccgccgcctttcaccacc
tcgacattgcagcaggaagccgcgcgcaagcttggcctctcggccagcgagacgatgcgc
gtagctcagcagctctacgaggacggcgcgatcacctatatgcggaccgatggcgtgcag
atggacgaaagcgccatttccgccgcgcgcaatgccatcgcgaagcgctatgatggtggc
tatctgccggacaagccccgccactaccagaccaaggccaagaacgcccaggaagcgcac
gaagcgatccggcccaccgacttcagtcgggaaagcgctggctcgggtgtccatgccaag
ctttacgacctcatcttcaagcgtgcgctggcaagccagatggcgtccgcgcgactggag
cgcaccgccgtcgaactgacggacggcactggccagcatgtcctgcgcgccaccggacag
gtggtgctctttccgggttttctggcactctacgaagagggccgggacgatcctgtcggc
cggcagggtgctggggatggagaggatgaggaaagcaggctgctgcccgcgctcaaggcg
ggggatcagccggccaagaaggacgtgcgcgccgaccagcatttcacgcagccgccaccg
cgctacagcgaggcgagcctcgtcaagcggctggaggaactggggatcggtcgcccctcg
acttatgcctcgaccatccagacgctcaaggaccgcgactatgtgcgcatcgagaagaac
cggttcttcgcggaggagagcggtcggctggtgacggcattcctcgagcgtttcttcgag
cgttatgtgtcctacgatttcacggcgggccttgaagaggaactggacgagatttccggt
ggccgcgcgcagtggcagcaggtgctcgaagccttctggcgggatttcaagcccaagacc
gccgagatcatggagcagaagccgagcgagatcacggccgcgctggacgaatatctggcg
cccatgctgttcccggacaaaggcgatggcagcgatccgcggctctgcccgctctgccac
gacggccggctgtcactgaggggcgggcgctatggagcgttcattgcctgctccaactat
cccgaatgccgctacacccgcaaattcggacagcccggtggcgccgatggcgatgcagcc
gggggcaatgaggagctcggcacgcatccggaaaccggcgagccgatcctgcgcaagtca
ggacgcttcggcccctatgtcgagatgggaagcggcaaggaggcaaagcgcgcgtccatt
cccaaggatctgcccaatggcgaactgacgctggactgggcgaccagactgctttcgctg
ccacgcaccattggcgatcatcccgagaccggcaagccgatcacggcgagcctcggacgc
tatggcccttatcttgcacatgacggcaaatatgcgcggctcgcctccacggccgagatc
ttcgagaccggtatgaacgccgccgtcgccaagctggccgatgcagcgaaccggggcggc
gcccgcaaggcggccgagccgctcaagatactcggcgcgcatccgcgcacggaagcggag
attcggctcatggagggacgctatggcccttatgtgaccgacggcaccaccaatgcgacg
ctgccgaagacagtcgcgcccgatgcgctgacgctggaggaagccgcacagctgatcgac
gagcgcgcggccaaggcgcctgccgggaagcgcaagggcaaggcgaagtccagcgccggc
aagtcaggcgccgcgaagaaaacgacagtgaagggaaaggcaccgtccaaagccaagagc
aaggccccggccgccgcggaatga

DBGET integrated database retrieval system