KEGG   Saccharothrix syringae: EKG83_17795
Entry
EKG83_17795       CDS       T06258                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
ssyi  Saccharothrix syringae
Pathway
ssyi00997  Biosynthesis of various secondary metabolites - part 3
ssyi01100  Metabolic pathways
ssyi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssyi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    EKG83_17795
Enzymes [BR:ssyi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     EKG83_17795
SSDB
Motif
Pfam: DeoC OMPdecase DHquinase_I AP_endonuc_2 NMO
Other DBs
NCBI-ProteinID: QFZ19057
UniProt: A0A5Q0GY81
LinkDB
Position
4059261..4060049
AA seq 262 aa
MSQPQSFGACLRLDRINRNGDGRLMIVPLDHSVADGPVTPDDSLDELVGELAGAGVDAVV
LHKGTARHLDPKRFVNTSLIVHLSASTSHAPDPDAKYLVTTVEAALRLGADAVSVHVNMG
SRQEAAQIADLARTAEETDRWGVPLLAMMYARGPQITDSTDPELVKHSATLAADLGADIV
KVSYPGSAEAMADVARACPIPVVVAGGPPVDEKRVLLERVASAVRAGAAGVAMGRNIFQH
PKPGRLAREIGDVVHGRMALAA
NT seq 789 nt   +upstreamnt  +downstreamnt
ttgagccagccacagtccttcggcgcgtgcctgcgcctggaccgcatcaaccgcaacggc
gacgggaggttgatgatcgtcccgctggaccactccgtggccgacgggccggtcaccccg
gacgactcgctcgacgagctggtcggcgagctggccggcgccggcgtggacgcggtggtc
ctgcacaagggcaccgcccgccacctggaccccaagaggttcgtcaacacctcgctgatc
gtgcacctgagcgccagcacgtcccatgcgcccgacccggacgccaagtacctggtgacc
accgtcgaggccgcgctgcggctgggcgcggacgcggtgagcgtgcacgtgaacatgggg
tcgcggcaggaggccgcgcagatcgccgacctggcccgcaccgcggaggagaccgaccgc
tggggcgtgccgctgctggccatgatgtacgcgcggggcccgcagatcaccgactccacc
gaccccgagctggtcaagcactcggccacgctggccgccgacctgggcgcggacatcgtc
aaggtcagctaccccggttcggccgaggcgatggccgacgtcgcgcgggcgtgccccatc
cccgtcgtggtggccggcggtccgccggtggacgagaagagggtcctgctggagcgggtc
gcctcggcggtgcgcgcgggcgcggcaggcgtggcgatgggccgcaacatcttccagcac
cccaaaccgggccggttggcccgcgagatcggcgacgtcgtgcacggccgcatggcgctc
gccgcctga

DBGET integrated database retrieval system