KEGG   Serratia symbiotica: SCc_634Help
Entry
SCc_634           CDS       T01672                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ssz  Serratia symbiotica
Pathway
ssz00550  Peptidoglycan biosynthesis
ssz01100  Metabolic pathways
ssz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ssz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCc_634 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SCc_634 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssz01003]
    SCc_634 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssz01011]
    SCc_634 (mrcA)
Enzymes [BR:ssz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SCc_634 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SCc_634 (mrcA)
Glycosyltransferases [BR:ssz01003]
 Polysaccharide
  Bacterial polysaccharide
   SCc_634 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:ssz01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SCc_634 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AEW44759
UniProt: R4I1J6
LinkDB All DBs
Position
complement(1479182..1481740)
Genome map
AA seq 852 aa AA seqDB search
MKCIKYFLIFVIYCTLLGVVSVFSLYKYIEAELPDVATLKDIRLQIPMQVFSADGELIAQ
FGEKRRIPLRLNQIPSVMVYAFIATEDSRFYEHYGVDPVGIFRAVCIALLSGHVSQGAST
ITQQLARNFFLSPERTIMRKIKEVFLALRIELMLSKDDILELYLNKIYLGYRAYGVGSAA
QVYFGKDISQLSLSEIATLAGLPKAPSTFNPLYSNIRAVTRRNVVLMRMLEEHYITQAQY
DQASTEHLVAHYHAPKISFSAPYLSEMVRQEMIIRYGERAYTDGYKVYTTITKRLQLAAE
QAVLNNVFAYDMRHGYRGPSKVLWKVSAAAWDKNQIISALKNLPHYHTLLPAVITSSAAQ
TATAMLADGSNIVLPLDTMYWARPYRSDTQQGIVPKYVTDVVLTGQQVWVRRINHTWWLS
QVPDVNSALVSINSKNGAVKALIGGFDFTQSKFNRVTQSLRQVGSNIKPFLYTAALDKGM
TLATILNDLPLTRWDANAGNDWRPKNSPPSYAGPIRLRQGLGQSKNVVMVRVIRAIGVDY
AAEYLQRFGFPAQNIVHSESLALGSASFTPMQLVRGYAVLANGGYLVKPYFISKIEDNSG
NTVFITTPQEVCSHCDTPVIYGDPQDSMLLSDDNIDNVTPLQGSHNSNVPIPRLERSPST
QNQLEDDQQHAPHVISCQLAFLLYDALTSNIYGEQGWKGTAWRSGRDLHRHDIGGKTGTT
NSSKDAWFSGYGPDTVTSVWIGFDDYRRDLGCATPSGFIPNQIFGGEGGSNSAQPAWNDF
MKIALEGIPEQKITPPAGIISVTIDNTSGKLSDGGSNSRPEYFIEGTQPRDYPSSDSGIT
LMTADGERHELF
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtgtataaagtattttttaatctttgtgatatattgtactttattgggagtagtc
tctgtttttagcctgtataaatatatagaggcagagctgcctgatgttgcaacacttaaa
gatattcggctacagataccgatgcaggtttttagcgcggatggtgagttaattgctcag
tttggcgaaaaacgccgaatcccattaagactaaatcaaattccatcagtgatggtatac
gcatttattgctactgaagatagtcgcttctatgagcattatggcgttgatccagttggt
atttttcgtgccgtatgtattgctttgctttctggtcatgtatcgcaaggagcaagtact
attactcagcagttagctagaaacttttttttaagtccagaacgtactattatgcgtaag
atcaaggaagttttcttagcattacgcattgagctaatgttatctaaggacgatattctt
gaattgtatctgaataagatttatttaggttaccgtgcttatggtgtaggctctgctgca
caagtttacttcggtaaagatattagtcagctgagcttaagtgaaatagctactcttgct
ggtttgccaaaagcaccttctacctttaacccgctttattctaatattcgtgctgtcact
cgtcgtaatgtcgtgttgatgcgtatgctagaagagcattatattactcaggcacagtat
gatcaggctagtactgaacatttagtagctcattaccatgcaccaaaaattagtttttct
gctccttacctctctgagatggtgcgtcaggaaatgattattcgttatggtgaaagagct
tatactgacggctataaagtatatactactattactaaaagattacagttggcagcagag
caggctgttctgaataacgtatttgcttatgatatgcgtcatggttatcgcggtccttct
aaggtgctctggaaagttagcgccgccgcttgggataaaaaccagattattagtgcttta
aaaaatttacctcactatcatacgttattgccagctgtaattacctcttctgctgctcag
acagctacagcaatgttggcagacggtagtaatattgttttaccgttagataccatgtat
tgggcacgtccttatagatcagatactcaacaaggaatagtgccaaaatatgttactgat
gtagtattgaccggtcagcaggtttgggtgcgtaggattaatcatacttggtggttatcc
caggtaccagatgttaactcagcactggtgtcgataaattcgaaaaatggtgcagtaaag
gcgttgattggtggttttgattttactcaaagtaaatttaatcgagtgacccaatcatta
cgtcaggttggttcaaatattaaaccatttctgtatacggctgcattagataaggggatg
acgctagctactattttaaatgatttgccacttactagatgggatgctaatgctggtaat
gactggcgaccaaaaaattcacctccgagctatgctggccccattcgcttgcgtcaaggg
ttagggcaatctaagaatgtagtgatggtaagagtaatacgtgctataggtgttgattat
gcggcagaatatctacagcgctttggttttcctgcgcagaatatcgtgcatagtgaatca
ctggcattgggctcagcgtcttttactcccatgcagttagtacgtggttatgcagtgtta
gcaaacggtggttatttagtaaaaccgtactttatttctaaaatagaagataatagcggt
aatactgtatttatcacaacgcctcaggaagtttgtagtcattgtgatacgccggtgatt
tacggtgatcctcaagactcaatgttattatctgatgataatattgataacgttactccg
ctacaaggaagtcataacagtaatgtaccaataccccgattagagagatctccctctacc
caaaatcagttggaggatgatcagcagcatgctccacatgtgattagttgccaactagca
tttttgctttatgatgcattaactagtaatatatatggtgagcaagggtggaagggcaca
gcctggcgctcagggcgtgatttgcatcgtcatgatattggtggtaaaactggtaccact
aatagctcgaaagatgcttggttctctggctatggtccggatactgtaacatctgtgtgg
atcggttttgatgattatcgccgtgatttaggctgtgcaacgccctcagggtttattcca
aatcagatttttgggggtgagggtggatctaatagcgcgcaaccagcatggaatgatttt
atgaaaattgcactagagggtatcccagagcagaagattaccccgcctgcaggaattatt
agcgtgactatagataatactagcggtaagctgtctgatggcggtagtaatagtcgtcct
gaatattttattgaaggcactcaaccaagagactatccatcaagtgatagcggcataact
ttgatgactgctgacggcgaaagacatgagttgttctaa

DBGET integrated database retrieval system