KEGG   Serratia symbiotica: SCc_737Help
Entry
SCc_737           CDS       T01672                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ssz  Serratia symbiotica
Pathway
ssz00061  Fatty acid biosynthesis
ssz00620  Pyruvate metabolism
ssz00640  Propanoate metabolism
ssz01100  Metabolic pathways
ssz01110  Biosynthesis of secondary metabolites
ssz01120  Microbial metabolism in diverse environments
ssz01130  Biosynthesis of antibiotics
ssz01200  Carbon metabolism
ssz01212  Fatty acid metabolism
Module
ssz_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ssz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCc_737 (accC)
   00640 Propanoate metabolism
    SCc_737 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SCc_737 (accC)
Enzymes [BR:ssz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SCc_737 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SCc_737 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEW44838
UniProt: R4I1Z1
LinkDB All DBs
Position
complement(1662293..1663654)
Genome map
AA seq 453 aa AA seqDB search
MLDKVVIANRGEIALRILRACKELGIKTVAVHSIADRDLKHVLLADETVCIGPASSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIGPKAETIRLMGDKISAI
HVMKTAGVPCVPGSAGPVSEDIDKNYDLAKHIGYPVIIKASGGGGGSGMRVVHSATDLEM
SINMTKVEAKAAFNNDIIYMEKYLDNPRHIEIQVLADGKGNAIYLAERDCSMQRRHQKVV
EEAPAPGITSDIRRYIGECCSKACVAINYRGVGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMISGVDLLKEQLRIAAGLPLLVKQCEVHTHGHAVECRINAEDPYTFLPSSGKITRFHAP
GGFGVRWESHIYTGYTVPPYYDSMLGKLITYGENRDVAIIRMKNALAELIIDGIKTNIKL
QQKIMNDENFQYGGTNIHYLEKKLNTRGIDKEY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaagttgttatcgctaatcgtggcgagatagcattgcgtattttacgtgct
tgtaaagagttaggtattaagaccgtagcagtgcattctattgcggatcgtgatctaaaa
catgtattgttagctgatgagaccgtgtgtattggcccggcatcatcagtaaaaagttac
ttaaatatacctgctattatttctgcagcagaaattactggtgcagttgcgattcaccca
ggatatggtttcttgtctgagaacgctgatttcgctgagcaggttgaacgttcaggattt
atctttattggtccaaaagctgaaactattcgtcttatgggggataaaatttctgctatt
catgtgatgaagacagctggggtgccttgtgtacctggttctgcaggtcctgtatctgaa
gatatagataaaaattatgatttggctaaacatattggttaccctgtgataatcaaagcg
tccggtggtggtggtggtagtggtatgcgtgttgtacatagcgccacagatctagagatg
tccattaatatgacaaaagtagaagcgaaagctgcttttaacaatgacataatttatatg
gaaaagtatctggataatccacgtcatattgagattcaagtattggctgacggtaagggc
aacgctatttatttggctgagcgcgattgctctatgcagcgacgccaccagaaagtagta
gaagaggcaccagcaccaggcattaccagtgatattcgccgttatattggtgaatgttgt
tcgaaagcttgtgttgcaattaactaccgaggcgtaggtacttttgagtttttatatgaa
aatggtgagttttattttattgaaatgaatacacgtattcaggttgagcatccagtgaca
gagatgattagcggtgtggatttacttaaagagcaactgcgaattgccgctggcctaccg
ttactagttaagcagtgcgaggtgcatactcacggccatgcggtggaatgccgtatcaac
gctgaagacccatatacctttttgcctagttctggtaagattacccgttttcatgcgcca
ggtggttttggtgttcgctgggaatctcatatttatactgggtatacagtaccgccgtac
tatgattctatgctcggtaagttaattacttatggtgaaaatcgtgatgtagcgattatt
cgcatgaagaacgcattggctgagttaattattgatggcataaaaacaaatattaagtta
cagcaaaagattatgaacgatgaaaattttcagtatggcgggacaaatatacactatttg
gagaaaaaattaaatacacgagggattgataaggagtattag

DBGET integrated database retrieval system