KEGG   Spirochaeta thermophila DSM 6192: STHERM_c06970Help
Entry
STHERM_c06970     CDS       T01315                                 

Gene name
sps1
Definition
(GenBank) serine/threonine-protein kinase Sps1
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sta  Spirochaeta thermophila DSM 6192
Brite
KEGG Orthology (KO) [BR:sta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sta01001]
    STHERM_c06970 (sps1)
Enzymes [BR:sta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     STHERM_c06970 (sps1)
Protein kinases [BR:sta01001]
 Serine/threonine kinases: Other
  Bacterial family
   STHERM_c06970 (sps1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1 APH Kdo
Motif
Other DBs
NCBI-ProteinID: ADN01655
UniProt: E0RRF4
LinkDB All DBs
Position
778298..780154
Genome map
AA seq 618 aa AA seqDB search
MAEQPKEIGNYKVISLLARGGMGAVYKALHPVLKRHVVIKKLALKGRKEVIERFKREAKI
LLDCKDPRIVHMYDYFTEGRSHYIVMEFVDGMAVDVLVKQRRYLPAPLALYVLREVCYAL
KYAHDRGIVHRDIKPANILISKEGEVKLTDFGIAAVESDEEEDLTREGMTLGTPSYMPPE
QFKDAKHVDKRADIYALGVMLYEMVTGKRPFPGNFAPETIMMIQKGRYLPVKKLNPDVPR
TVSRIIRRTINPNPRRRFQDVAQIIRMVERYLSRFDEAELRHTLSAMVLQPAIPEPEFRQ
RRRGGLVAALLAFGVLLLGGAGYAGWRTGFIQETVLASRYGRLDVEVRVPAGVKEPEELF
VKGVLFINDRNEIPPAPYPPLRFEFVGEEGETLVFSSRPLYVAPGAYRLKLMVENRVYWY
SWEILPLSEGGLPPLLVDVGEVAVRPLRVEGVARDALSGTRILEGVRFLVLLDGRWVSID
EVEAGRLVTGRVWRFRAEAEGYYPEVFSLLIRPGQDELILSAALVPKPGRLVLSAPEGVT
FLLDGKERVRAGGQDLGWVDLSVYRGGEGVWDLPSGRYEATVRKGGEEARLVFLLPPEGE
VRLSVREGEGGLMLMKEE
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaacagcccaaggagataggcaactacaaggtgatctcgctcctcgcacggggc
ggcatgggtgcggtgtacaaggccctccaccccgtgctcaagcgccacgtggtgataaag
aagcttgccctcaaggggcggaaggaggtcatcgaacgcttcaaacgtgaggcgaagatc
ctcctcgactgcaaggaccccaggatcgtccacatgtacgactatttcacggagggacgt
tcccactacatcgtgatggagttcgtggacgggatggccgtggatgtgctcgtcaagcag
cggcgctacctccctgcgcccctcgccctctatgtcctccgcgaggtgtgctatgccctc
aagtatgcgcacgaccgaggtatcgtgcacagggacatcaaaccggccaacatcctcata
tccaaggaaggtgaggtcaaactcaccgacttcggcatcgccgccgtggagagcgacgag
gaggaggatctcacccgagagggaatgaccctcggcacgccttcctacatgccacccgag
cagttcaaggatgcgaaacacgtggacaaacgggccgacatctacgccctcggcgtgatg
ctctatgagatggtgacgggtaagcgtccgtttcccggcaatttcgctcccgagaccatc
atgatgatccagaaggggcgctacctcccggtgaagaagctcaatcccgatgtgccccgc
acggtgagcaggatcatccgcaggaccatcaatcccaatccccggaggcggttccaggat
gtggcccagatcatccggatggtggagcgctacctctcgcgcttcgatgaggccgagctc
aggcatacgctctcggccatggtgctccagcctgcgatccccgagcccgagttcaggcaa
cggaggcggggagggctcgtggcggcgcttctcgcattcggtgtgctcctcttgggtggt
gcggggtacgcgggatggcggaccggtttcatccaggagacggtactcgcctcacggtac
gggcgccttgacgtggaggtgcgggtgccggccggggtgaaggagccggaggagcttttc
gtcaagggggtgctcttcatcaacgaccggaacgagatcccacctgcgccgtatccaccg
ttgcgcttcgagttcgtaggggaggagggggaaaccctggtcttctcgtcccgccccctg
tacgtggcgcccggtgcctatcgtctcaaactcatggtggaaaacagggtgtactggtat
tcctgggagatccttcctctctccgagggtgggcttccgcctcttctcgtggatgtgggc
gaggtggccgtccgtccgctcagggtggagggcgtagcccgtgacgccctcagcggcacg
aggatcctggaaggggtgcggttcctcgtgctcctcgacggtcgctgggtgtcgatcgat
gaggtggaggcagggagactggtgaccggacgcgtgtggcgcttccgggcagaggcagag
gggtactaccccgaggtcttctccctcctcatacgcccggggcaggacgagcttatcctc
tccgccgccttggtgccgaaaccggggaggctcgtgctctcggcgcccgagggcgtcacg
ttccttctcgacgggaaggagcgggtacgtgcagggggacaggatctcgggtgggtggat
ctctctgtctaccgcggaggggaaggtgtctgggatctcccctccggtcgatatgaggcc
acggtgcgcaaggggggggaggaggcccgtttggtcttcctccttccccccgagggagag
gtgcggctctcggtgcgtgaaggggagggtggactcatgctcatgaaggaggagtag

DBGET integrated database retrieval system