KEGG   Stanieria sp. NIES-3757: STA3757_01260Help
Entry
STA3757_01260     CDS       T05130                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00473  D-Alanine metabolism
stan00550  Peptidoglycan biosynthesis
stan01100  Metabolic pathways
stan01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    STA3757_01260
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STA3757_01260
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    STA3757_01260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stan01011]
    STA3757_01260
Enzymes [BR:stan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     STA3757_01260
Peptidoglycan biosynthesis and degradation proteins [BR:stan01011]
 Precursor biosynthesis
  Amino acid ligase
   STA3757_01260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: BAU62775
UniProt: A0A140K098
LinkDB All DBs
Position
complement(136438..137529)
Genome map
AA seq 363 aa AA seqDB search
MTTTKNISTARVESYLQTPFLSVLHLVGSAVSEFYYKLSLIYAREVVQPAKVRSYYAVVH
PDGLWQLGASLDKLSVKIPFSKAIARLPQIDVVVPHMFCFPGMTSYRALFEDILGIPVVG
SRAECTALATNKSHTRNIVSSVGVRIAKAQQFKKGDLLNIELPFIVKPNSEDNSMGISLV
KNESEIETALQIGFEYDDTLLIEEYIPGRELRVGVIEKEGELYVLPAIEYLLTEDKPIRT
VDSKLGTKSDGMLIRQPVNIACPAQVSPQLWDKLTEAVKNAHQALGCRDYSLYDFRIHSQ
TQEPYLLESCSFWSFINASVLSRMLEADNHKLEEVALMLWNNAAKRTRVACGSLFKYINT
DHN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacaaaaaatatttcgacagctagagtcgaatcttatttacaaactcctttt
ttatcagttttacatttagttggttctgctgtctccgagttttactacaaattgtctttg
atctatgcaagagaagtagtacaaccagcaaaggttagaagttattacgccgtagtgcat
cccgatggtttatggcagcttggcgcatctttggacaaactatccgttaaaatacctttc
tcaaaagcgatcgctcgactacctcaaatcgatgtagttgtgcctcatatgttttgtttt
cctggaatgactagttatcgagccttatttgaagatatcttaggtattcctgtagtaggt
tctagagcagagtgtaccgcattagctaccaataaatctcataccagaaatattgtatcg
tccgtaggcgttcggatcgcaaaagcacagcaatttaaaaaaggcgatctcttaaatata
gaattaccttttatcgtcaaacccaactctgaagataattcgatggggataagtctagtc
aaaaacgaatctgaaatcgaaactgccttgcaaatagggtttgaatatgacgataccctg
ctaatagaagaatacattccaggtagagaattgcgcgttggtgtgatcgaaaaagaagga
gaattatacgtcttacccgcaattgaatatttattaaccgaagacaaaccgattagaacc
gtagatagtaaactaggtactaaatctgatggcatgctaatcaggcaaccagttaatatt
gcttgtcctgctcaagtatctccccaattgtgggataaactaactgaagcggtcaaaaat
gcccatcaagctttaggatgtcgcgattattccctctatgattttcgcatccattcccaa
actcaagaaccctatctgctagaatcttgttctttttggtcgtttattaacgctagtgtg
ttgtcgagaatgctagaagcggacaatcacaaattagaagaagtagcattaatgttatgg
aacaatgcagccaaacgaacccgtgtagcttgtggttctctatttaaatatatcaacacc
gatcataattaa

DBGET integrated database retrieval system