KEGG   Stanieria sp. NIES-3757: STA3757_09290Help
Entry
STA3757_09290     CDS       T05130                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00260  Glycine, serine and threonine metabolism
stan00630  Glyoxylate and dicarboxylate metabolism
stan00670  One carbon pool by folate
stan01100  Metabolic pathways
stan01110  Biosynthesis of secondary metabolites
stan01130  Biosynthesis of antibiotics
stan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STA3757_09290
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STA3757_09290
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    STA3757_09290
Enzymes [BR:stan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     STA3757_09290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG POPLD DUF2106
Motif
Other DBs
NCBI-ProteinID: BAU63564
UniProt: A0A140K2I7
LinkDB All DBs
Position
1029566..1030681
Genome map
AA seq 371 aa AA seqDB search
METLSWLRTPLFELSQQQQARFTPFAGWEMPVQYGGLKHEHHAVRTKAGMFDISHMGKFG
LQGKDLVKQLQALVPSDLSRLESNQAQYTVLLNPQGGIIDDIIFYYQGKQQDLEQGILIV
NAATTDKDKQWLLKHLAGSSVELTDFSREQVLIALQGPEAVNYLQPLVDGDLNSLAAFGH
QQVQIEGKPAFIARTGYTGEDGFEIMVEPEVGKSLWQKFSEAGVTPCGLGARDTLRLEAA
MCLYGQDIDETTTPLEAGLGWLVHLDKKEDFIGREVLEQQKQAGVQRRLVGLQMEGRYIA
RHGYPIISGREMVGEVTSGTLAPTVAKAIALGYVPKSLSKVGQKLEVEIRGKTYPAVVVK
KPFYRSPHRAV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggaaacattatcttggttacgtactcctttatttgaactatcacagcaacaacaagca
cgatttacgccttttgctggctgggaaatgccagtacagtatgggggattaaaacacgaa
caccacgcagttcgtaccaaggcaggaatgtttgatatttctcacatggggaaatttggt
ttacaaggaaaagatttagttaaacagttacaggctttagttccttctgatttgagcaga
ttagaatccaatcaagcacaatacactgttttgcttaatcctcaagggggaattattgat
gatattattttctactatcagggtaaacaacaagatttagaacaaggtatcttaattgtt
aatgctgctactacagataaagataaacagtggttattgaagcatttagcaggtagttcg
gttgaattaacagatttttctagggaacaagttctcattgcgcttcaagggccagaagcg
gttaattatttgcaacctttggttgatggtgatttgaattctttagcagcttttggacat
caacaagtacaaattgaagggaaacctgcctttattgctagaactggttatacaggagaa
gatggttttgaaatcatggttgaaccagaagtaggcaaaagcttgtggcaaaaattcagt
gaggcaggggttactccttgtggtttaggtgctagggatacgttgcggttagaagcagct
atgtgtttgtatgggcaggatattgatgaaactactactcccttagaagctggtttgggt
tggttagttcatttggataaaaaggaagactttattggcagagaagttttagaacaacaa
aaacaggcaggagtacaacgtcgcttggttgggttgcagatggaaggcagatatatcgcc
cgtcatggttatccgattatctctgggagagaaatggtaggagaagtaactagtggtact
ttagcacctactgtagctaaagcgatcgctcttggttatgtgccaaaatctttaagtaaa
gtgggacaaaaattagaagtggaaattcgcggaaaaacttatcctgcggttgtagtgaaa
aagccattttatcgttctccccatcgcgcagtctag

DBGET integrated database retrieval system