KEGG   Stanieria sp. NIES-3757: STA3757_10690Help
Entry
STA3757_10690     CDS       T05130                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00473  D-Alanine metabolism
stan00550  Peptidoglycan biosynthesis
stan01100  Metabolic pathways
stan01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stan00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    STA3757_10690 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STA3757_10690 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    STA3757_10690 (ddl)
Enzymes [BR:stan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     STA3757_10690 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:stan01011]
 Precursor biosynthesis
  Amino acid ligase
   STA3757_10690 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: BAU63702
UniProt: A0A140K2X5
LinkDB All DBs
Position
complement(1196227..1197336)
Genome map
AA seq 369 aa AA seqDB search
MTNNYGVVSKGNFDVGRFMARTKIGLLFGGCSGEHEVSISSAKAIASALSQGENLNHYEV
IPVYIAKNGIWYAGDIAHNILNTKQPLEVETNQSRWQFPALVSEIEVWFPILHGPNGEDG
TVQGLLQLMQVPYVGSGVLGSAMGMDKIAMKNAFAKAGLPQVQYMAVTRSQIWSSPCVFP
KLCDEIEATLDYPCFVKPANLGSSVGIAKVRNRQELETALDNAASYDRRIIVEAGVTARE
VECAVLGNDYPKASVVGEISFNSDFYDYETKYTEGLAQLHIPAQIPDAIAAKIQDMSLQA
FAAVDAAGLARVDFFYIEATGEVLINEINTLPGFTATSMYPQMWAATNVPFPELVNRLIQ
FAIERHQGS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataactatggtgtagtatcaaagggaaattttgatgtcggtagattcatggca
agaacaaaaattggcttattattcggcggttgttcaggagaacatgaagtttccattagt
tcagcaaaagcgatcgcatcagctttgagtcaaggagagaatctcaatcattacgaagtt
atacctgtttatattgccaaaaatggaatttggtacgctggcgatatcgctcataatatc
ctcaatactaaacaacctctagaagtagaaacgaatcaaagtagatggcaatttcctgct
ttagtctcagaaatagaggtatggtttcccattctgcatggtcctaatggggaagatggc
acagtacagggtttattacaactgatgcaagttccttatgttggcagtggtgtactgggt
tcagcaatgggaatggataaaattgccatgaaaaatgcttttgccaaggcgggattaccc
caagtacaatacatggcagttacaagatcgcaaatttggtctagtccttgtgtttttccg
aaactctgcgatgaaatcgaagcaactctagattatccttgctttgttaaacctgctaat
ttgggttcttctgtcggcattgctaaagtaagaaatcgccaagaattggaaactgccctt
gataatgctgcgagttacgaccgacgtattattgttgaagcaggcgttactgctagagaa
gttgaatgtgccgttttgggtaatgattatcctaaagcttctgtagtaggagaaattagt
tttaatagtgatttttacgactacgaaaccaaatacaccgaaggattagcccaattacac
attcctgcccagattcccgatgcgatcgcagctaaaattcaagatatgtctctccaagct
tttgctgcggttgatgctgctggtttggcaagggtagattttttctatatcgaagcgact
ggtgaagttttaatcaacgaaattaatactctacctggttttactgctaccagtatgtat
cctcagatgtgggcagctactaatgtcccttttcctgaattggttaatcgtttaattcaa
tttgccatcgaacgtcatcaaggtagttaa

DBGET integrated database retrieval system