KEGG   Stanieria sp. NIES-3757: STA3757_22890Help
Entry
STA3757_22890     CDS       T05130                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00630  Glyoxylate and dicarboxylate metabolism
stan00710  Carbon fixation in photosynthetic organisms
stan01100  Metabolic pathways
stan01120  Microbial metabolism in diverse environments
stan01200  Carbon metabolism
Module
stan_M00165  Reductive pentose phosphate cycle (Calvin cycle)
stan_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
stan_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:stan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STA3757_22890 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    STA3757_22890 (rbcS)
Enzymes [BR:stan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     STA3757_22890 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small PAS_4
Motif
Other DBs
NCBI-ProteinID: BAU64911
UniProt: A0A140K6D4
LinkDB All DBs
Position
2495724..2496059
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSFLPPLTDQQIAKQIDYMLEQGFIPGVEFEKDPTPELHHWTLWKLPL
FDARNAQDVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNSNRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaccaaaagagcgtcgttacgaaaccctttcttttttacctcctttaacc
gatcagcaaatcgccaagcaaatcgattatatgctcgagcagggttttattcctggggtt
gagtttgaaaaagatcctactcctgaacttcaccactggactttgtggaagttaccttta
tttgatgccagaaacgctcaagatgtacttaatgaagttagagaatgtcgctctgaatac
tctgattgttacatccgtgtagttggttttgacaacattaagcaatgtcaaactgttagc
ttcattgtttacaaacccaattctaatcgctactaa

DBGET integrated database retrieval system