KEGG   Stanieria sp. NIES-3757: STA3757_24800Help
Entry
STA3757_24800     CDS       T05130                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00970  Aminoacyl-tRNA biosynthesis
stan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stan00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STA3757_24800 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:stan03029]
    STA3757_24800 (gatB)
Enzymes [BR:stan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     STA3757_24800 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     STA3757_24800 (gatB)
Mitochondrial biogenesis [BR:stan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    STA3757_24800 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey ddrB-ParB
Motif
Other DBs
NCBI-ProteinID: BAU65101
UniProt: A0A140K6X4
LinkDB All DBs
Position
complement(2713059..2714549)
Genome map
AA seq 496 aa AA seqDB search
MTTAAPKKIEYEAIIGLETHCQLNTETKIFSSESTKFDPDNPNTNISPICLGYPGVLPVL
NEKVLEYAVKAGLALNCTIAPYSKFDRKQYFYPDLPKNYQISQFDLPIAEHGWLEIEIAE
KPNSEPLKKRIGITRLHMEEDAGKLTHGGSDRLSGSTYSLVDFNRAGIPLLEIVSEPDLR
SGKEAAEYAQELRRIMLYLGISDGKMQEGSLRCDVNISIRPVGQEEFGTKVEIKNMNSFS
AIQKAIDYEIERQIEAVENGEPIIQETRLWEEGSQRTISMRSKEGSSDYRYFPEPDLPPI
EVSKTQLETWKAELPELPASKRHRYESELGLSAYDARVLTDDRTVAEYFEVAVTAGADAK
QAANWIMGDIAAYLKNTGLNITEIALKPENLAELIQLIDKGTISGKIAKDILPELLTKGG
SVQKLVESKGLIQISDTGELEKIIDEVIAANPNELAKFRSGKTNLKGFFVGQVMKKTSGR
ADPKLTNQLLDQKLSG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgactactgctgcaccgaaaaagatagaatacgaagcaatcattggcttagaaactcac
tgtcaactgaatactgaaaccaaaatctttagcagcgaatctaccaagttcgatccagat
aatcctaataccaacatttctcctatctgtctgggttatcctggtgtactgcctgttttg
aatgaaaaagttctcgaatacgctgttaaagcaggtttagctcttaactgtaccattgca
ccgtatagcaaatttgaccgaaaacagtatttttatcccgatttaccgaaaaattatcaa
atttctcaattcgatctgcccattgccgaacatggttggttagaaatcgaaattgcggaa
aaacctaactcggaaccactcaaaaaaagaattggcatcactcgcctacacatggaagaa
gatgcaggaaaattaactcacggtggaagtgacagactttctggttcaacttattcctta
gtagattttaatcgggctggtattcccttgcttgaaattgtttccgaaccagatttacgt
tcgggtaaagaagcagcagaatacgctcaagaattacgtcgcattatgctttatttaggg
attagtgacggtaagatgcaagaaggttctttgcgctgcgatgtgaatatttctattcgt
cctgtaggacaagaagaattcgggactaaagtagaaatcaagaatatgaactcctttagt
gcgattcaaaaagcgatcgactatgaaattgaacgtcaaatagaagcagttgaaaacggc
gaaccaattatccaagaaactcgtctgtgggaagaaggtagtcaaagaacaattagtatg
cgttctaaagaaggttctagtgattatcgttattttcctgaaccagatttacccccaatt
gaagtttcaaaaactcaactagaaacttggaaagcagaactaccagagttgccagcaagt
aaaagacatcgttatgagtcagaattaggattatctgcttatgatgccagagttttaact
gatgatcgcactgtggcagaatattttgaagttgctgtaacggctggtgcagatgccaaa
caagcagctaattggattatgggagatattgctgcgtatttaaagaatactggtttaaat
attacagaaatcgctctcaaacccgaaaatttagctgaattaattcaattaattgataag
ggtacgattagtggcaaaattgctaaagatatcttaccagaactgttaactaaaggtggt
tcagttcaaaaattagttgaaagcaagggattaattcaaatttctgatacgggagagttg
gaaaaaattattgatgaagtaatagctgctaatcccaatgaattagccaaattccgcagt
ggtaaaactaatctaaagggtttctttgttggacaagtaatgaagaaaaccagtggacgt
gctgatcccaaattaactaaccaattactagatcaaaaattgtcagggtaa

DBGET integrated database retrieval system