KEGG   Stanieria sp. NIES-3757: STA3757_34130Help
Entry
STA3757_34130     CDS       T05130                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00010  Glycolysis / Gluconeogenesis
stan00020  Citrate cycle (TCA cycle)
stan00620  Pyruvate metabolism
stan01100  Metabolic pathways
stan01110  Biosynthesis of secondary metabolites
stan01120  Microbial metabolism in diverse environments
stan01130  Biosynthesis of antibiotics
stan01200  Carbon metabolism
Module
stan_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STA3757_34130 (pdhC)
   00020 Citrate cycle (TCA cycle)
    STA3757_34130 (pdhC)
   00620 Pyruvate metabolism
    STA3757_34130 (pdhC)
Enzymes [BR:stan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STA3757_34130 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase PASTA ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAU66013
UniProt: A0A140K9I6
LinkDB All DBs
Position
3738730..3740031
Genome map
AA seq 433 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVEWTKSPGDKVAKGETVVVVESDKADMDVESFNEGYLAVIL
VEAGQEAPVGNAIALLAETEAEIEEAKQKAASHQGGSSSSATPKSESTPVATPGAVADQA
QTTSKTSSNGNGRIVASPRARKLAKEFGVDIKTIQGSGPYGRIVAQDIEQAAGKTPAPTP
VASQPVNTPVAPPSVSRPVTPPPTPVSVTPGETVPLNTLQKAVVQNMMVSLQVPTFHVNY
TITTDALDQLYKQIKSKGVTMTALLAKAVAVTLAKHPIVNASYSEGAIKYNSEINIAVAV
AMEGGGLITPVLRNADKLDIYSLSRSWKDLVDRSRLKQLQPDEYSTGTFTLSNLGMFGVD
RFDAILPPGQGSILAIGAARPQVVATEAGLFGVKRQMVVNMTSDHRIIYGSHAALFLQDL
AKLIETEPQSLTL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatatatttatgccggctcttagctccaccatgactgaaggaaaaattgtt
gaatggacaaaatcgccaggagacaaggtagccaagggtgaaactgtggtagtggtagag
tcggataaagccgacatggatgtagaatcctttaatgaaggttatttagcggttatatta
gttgaagcaggacaagaagcacccgtaggaaacgcgatcgctcttctcgcagaaactgaa
gcagaaatcgaagaagctaaacaaaaagctgcttcccatcaaggaggttctagctcctct
gctactcctaaatcagaatctactcctgtagctactcctggtgctgttgccgatcaagct
caaactacttcaaaaacttctagtaatggcaatggcagaattgtcgcttctccacgagct
agaaaactagctaaagaatttggtgtcgacatcaaaacgattcaaggcagtggtccttac
ggtagaattgttgcccaagatatcgaacaagcagcaggtaaaactcccgctcctactcca
gtggcatctcaaccagtaaacacgcctgtagcacctccttccgtatctcgtcccgttaca
cctcctccaacacccgtcagcgttactcctggtgaaactgtacccctcaatactctccaa
aaagctgtggtacagaatatgatggttagtttgcaagtacctaccttccacgtcaactac
accattactaccgatgctttagaccaactctacaaacaaattaagtctaaaggagtaact
atgacagctttactcgctaaagctgtagcggttactctagcaaaacacccgatagttaat
gctagctatagtgaaggagcaattaaatataattcagaaatcaatattgctgttgcagta
gcaatggaaggtggaggtttaatcacacctgttttacgcaatgcagacaagcttgatatt
tattccctctctcgcagttggaaagatttagtagaccgttctagactcaaacaactacaa
ccagatgaatatagcactggtactttcaccctatctaatttagggatgtttggtgtagac
cgcttcgatgccattttacccccaggacaaggttcgatcctagctattggtgctgctcgt
ccccaagtagtagctactgaagcaggattgttcggtgttaaacgccaaatggtggttaat
atgactagcgatcatcgtattatttatggctcacacgctgctttgttcttacaggattta
gcaaaattaattgaaacagagccacaatctttaactctttaa

DBGET integrated database retrieval system