KEGG   Stanieria sp. NIES-3757: STA3757_34130
Entry
STA3757_34130     CDS       T05130                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stan  Stanieria sp. NIES-3757
Pathway
stan00010  Glycolysis / Gluconeogenesis
stan00020  Citrate cycle (TCA cycle)
stan00620  Pyruvate metabolism
stan01100  Metabolic pathways
stan01110  Biosynthesis of secondary metabolites
stan01120  Microbial metabolism in diverse environments
stan01200  Carbon metabolism
Module
stan_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STA3757_34130 (pdhC)
   00020 Citrate cycle (TCA cycle)
    STA3757_34130 (pdhC)
   00620 Pyruvate metabolism
    STA3757_34130 (pdhC)
Enzymes [BR:stan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STA3757_34130 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase PASTA ATP-grasp
Other DBs
NCBI-ProteinID: BAU66013
UniProt: A0A140K9I6
LinkDB
Position
3738730..3740031
AA seq 433 aa
MIHDIFMPALSSTMTEGKIVEWTKSPGDKVAKGETVVVVESDKADMDVESFNEGYLAVIL
VEAGQEAPVGNAIALLAETEAEIEEAKQKAASHQGGSSSSATPKSESTPVATPGAVADQA
QTTSKTSSNGNGRIVASPRARKLAKEFGVDIKTIQGSGPYGRIVAQDIEQAAGKTPAPTP
VASQPVNTPVAPPSVSRPVTPPPTPVSVTPGETVPLNTLQKAVVQNMMVSLQVPTFHVNY
TITTDALDQLYKQIKSKGVTMTALLAKAVAVTLAKHPIVNASYSEGAIKYNSEINIAVAV
AMEGGGLITPVLRNADKLDIYSLSRSWKDLVDRSRLKQLQPDEYSTGTFTLSNLGMFGVD
RFDAILPPGQGSILAIGAARPQVVATEAGLFGVKRQMVVNMTSDHRIIYGSHAALFLQDL
AKLIETEPQSLTL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgattcacgatatatttatgccggctcttagctccaccatgactgaaggaaaaattgtt
gaatggacaaaatcgccaggagacaaggtagccaagggtgaaactgtggtagtggtagag
tcggataaagccgacatggatgtagaatcctttaatgaaggttatttagcggttatatta
gttgaagcaggacaagaagcacccgtaggaaacgcgatcgctcttctcgcagaaactgaa
gcagaaatcgaagaagctaaacaaaaagctgcttcccatcaaggaggttctagctcctct
gctactcctaaatcagaatctactcctgtagctactcctggtgctgttgccgatcaagct
caaactacttcaaaaacttctagtaatggcaatggcagaattgtcgcttctccacgagct
agaaaactagctaaagaatttggtgtcgacatcaaaacgattcaaggcagtggtccttac
ggtagaattgttgcccaagatatcgaacaagcagcaggtaaaactcccgctcctactcca
gtggcatctcaaccagtaaacacgcctgtagcacctccttccgtatctcgtcccgttaca
cctcctccaacacccgtcagcgttactcctggtgaaactgtacccctcaatactctccaa
aaagctgtggtacagaatatgatggttagtttgcaagtacctaccttccacgtcaactac
accattactaccgatgctttagaccaactctacaaacaaattaagtctaaaggagtaact
atgacagctttactcgctaaagctgtagcggttactctagcaaaacacccgatagttaat
gctagctatagtgaaggagcaattaaatataattcagaaatcaatattgctgttgcagta
gcaatggaaggtggaggtttaatcacacctgttttacgcaatgcagacaagcttgatatt
tattccctctctcgcagttggaaagatttagtagaccgttctagactcaaacaactacaa
ccagatgaatatagcactggtactttcaccctatctaatttagggatgtttggtgtagac
cgcttcgatgccattttacccccaggacaaggttcgatcctagctattggtgctgctcgt
ccccaagtagtagctactgaagcaggattgttcggtgttaaacgccaaatggtggttaat
atgactagcgatcatcgtattatttatggctcacacgctgctttgttcttacaggattta
gcaaaattaattgaaacagagccacaatctttaactctttaa

DBGET integrated database retrieval system