KEGG   Sphingomonas taxi: MC45_03135Help
Entry
MC45_03135        CDS       T03398                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
stax  Sphingomonas taxi
Pathway
stax00010  Glycolysis / Gluconeogenesis
stax00620  Pyruvate metabolism
stax00630  Glyoxylate and dicarboxylate metabolism
stax00640  Propanoate metabolism
stax00680  Methane metabolism
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC45_03135
   00620 Pyruvate metabolism
    MC45_03135
   00630 Glyoxylate and dicarboxylate metabolism
    MC45_03135
   00640 Propanoate metabolism
    MC45_03135
  09102 Energy metabolism
   00680 Methane metabolism
    MC45_03135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:stax01004]
    MC45_03135
Enzymes [BR:stax01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MC45_03135
Lipid biosynthesis proteins [BR:stax01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MC45_03135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AIT07957
UniProt: A0A097EK88
LinkDB All DBs
Position
715316..717253
Genome map
AA seq 645 aa AA seqDB search
MTDPEIYPITGDWTNASLDPRKYEDLYESAASSPGSFWLDQATKRLDWITAPTIGGDWSF
AKADFHIKWFADGQLNVAANCIDRHLAKHGDTVAIIWEPDEPSEEPRRITYRQLHDEVGR
FANVLKVHGVGKGDRVTLYMPMIPEAAYAALACARIGAIHSVVFGGFSADALAGRIEDCG
SKIVITADEGRRGGKRIKLKACVDEAAARAPTLETVIVVKATGAEVAMGPRDIWYHEAAA
GVGSDCPAETMAAEDPLFILYTSGSTGKPKGVLHTSAGYLLWADFTFKIAFDYKPGQVFW
CAADIGWVTGHTYLLYGPLSNGGTTLMYEGLPTWPDASRIWQVVDRHKVHTLFTAPTALR
ALMKEGDDFVRRTDRSSLKLLGSVGEPINPEAWRWYHDVVGEGRAPIVDAWWQTETGGIM
IAPLPGAVPMKPGSASKPLPGVVPQLVDDKGTVLTGAAQGNLCITQSWPGQMRGVWGDQD
RFFQTYFTTYEGKYFTGDGCRRDGDGYYWITGRVDDVINVSGHRMGTAEVESALVLHEAV
AEAAVVGMPHEVKGQGIYAYVTLNAGREGDEALRSALVAWVRQEIGPIASPDKLQFAPAL
PKTRSGKIMRRILRKIAEGDVTALGDTSTLADPAVIDDLVANRIV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcctgaaatctacccgatcaccggcgactggaccaacgccagcctcgacccc
aggaaatacgaagacctttacgaatccgcggcgagcagcccgggcagcttctggctcgat
caggcgaccaagcggctcgactggatcacggcgccgacgatcggcggcgactggtcgttc
gccaaggccgacttccacatcaaatggttcgccgacggccagctcaacgtcgcggccaat
tgcatcgaccgccatctcgccaaacacggcgataccgtcgcgatcatctgggagcccgac
gagccgtcggaagagccgcgtcgcatcacctatcgccagctccatgacgaggttggccgc
ttcgccaacgtgctgaaggtgcatggcgtcggcaagggcgaccgcgtcacgctctacatg
ccgatgatccccgaggcggcctatgccgcgctcgcctgtgcgcggatcggcgcgatccat
tcggtcgtgttcggcggattctccgccgatgcgctcgccggccggatcgaggattgcggg
tcgaagatcgtcatcaccgccgacgaaggccgtcgcggcggcaaaaggatcaagctcaag
gcgtgcgtcgacgaagccgccgcgcgcgcgccgacgctggagacggtcatcgtcgtcaag
gcgaccggcgccgaggtggcgatggggccgcgcgacatctggtatcacgaggccgccgcc
ggcgtcggcagcgactgcccggcggagacgatggcggcggaagacccgctgttcatcctc
tataccagcggttcgaccggcaagccgaagggcgttctccacacctccgccggctatctg
ctgtgggcggatttcaccttcaagatcgcgttcgactacaagccggggcaggtcttctgg
tgcgccgccgatatcggctgggtcaccggccacacctatctgctctacggcccgctctcc
aacggcggtacgacattgatgtacgaagggctgccgacctggcccgacgctagccgcatc
tggcaggtggtcgaccgccacaaggtccatacgctgttcaccgcgcccaccgcgctgcgc
gcgctgatgaaggagggcgacgacttcgtccgcaggaccgatcgctcgtcgctcaagctg
ctcggctcggtcggcgaaccgatcaatccggaggcgtggcgctggtatcacgacgtcgtc
ggcgaaggccgcgcgccgatcgtcgacgcctggtggcagaccgagaccggcgggatcatg
atcgcccccctgcccggcgcggtgccgatgaagccggggtccgcctcgaaaccgctgccc
ggcgtcgtgccgcagctcgtcgacgacaagggaacggtgctgaccggcgcggcgcaggga
aatctgtgcatcacgcaaagctggcccggccagatgcgcggcgtctggggcgatcaggat
cgtttcttccagacctatttcaccacctacgagggcaagtatttcaccggcgacggctgc
cgccgcgacggcgacggctattactggatcaccggccgggtcgacgacgtcatcaacgtc
tcgggccatcgcatggggaccgccgaggtcgagagcgcgctggtgctgcacgaggcggtc
gccgaggcggcggtggtcggcatgccgcacgaggtaaagggtcagggcatctacgcctat
gtgacgctcaacgccggacgagagggcgacgaggcgttgcgcagcgcattggtggcctgg
gtgcggcaggagatcggcccgatcgccagccccgacaagctgcaattcgcgccggccttg
cccaagacgcgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgagggcgac
gtgaccgcgctgggtgacacctcgacgctggcggacccggcggtgatcgacgatctggtc
gcgaaccgcatcgtctga

KEGG   Sphingomonas taxi: MC45_04570Help
Entry
MC45_04570        CDS       T03398                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
stax  Sphingomonas taxi
Pathway
stax00010  Glycolysis / Gluconeogenesis
stax00620  Pyruvate metabolism
stax00630  Glyoxylate and dicarboxylate metabolism
stax00640  Propanoate metabolism
stax00680  Methane metabolism
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC45_04570
   00620 Pyruvate metabolism
    MC45_04570
   00630 Glyoxylate and dicarboxylate metabolism
    MC45_04570
   00640 Propanoate metabolism
    MC45_04570
  09102 Energy metabolism
   00680 Methane metabolism
    MC45_04570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:stax01004]
    MC45_04570
Enzymes [BR:stax01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MC45_04570
Lipid biosynthesis proteins [BR:stax01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MC45_04570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DinB_2
Motif
Other DBs
NCBI-ProteinID: AIT05795
UniProt: A0A097EE21
LinkDB All DBs
Position
complement(1027087..1028994)
Genome map
AA seq 635 aa AA seqDB search
MSNATPLADRQAVHARSLADPDGFWLEAATRLDWMTAPSRAGDWSFDRDDFHIRWFEDGV
LNVAANCIDRHLATRGDQVAILWEGDDPTTAPRHITYAELHREVSRFANVLKGLGAGKGD
RITLYMPMIPEAAFAMLACARIGAVHSVVFAGFSAEALAGRIADCDSRIVITADQGRRGG
RTIALKACVDEALAIARAVDHVLVVRATGAEVPMTAGRDIWYHEAALNVAADCPPEPMAA
EDPLFILYTSGSTGKPKGVVHSTGGYLLWAAMTHATVFDYTAPDVYWCAADIGWVTGHSY
IVYGPLANGATTLMYEGVPNWPTPARIWEVVDRHRVTTLYTAPTALRALMKEGDAYVTGT
SRASLKLLGSVGEPINPEAWRWYHDVVGGGRCPVMDTWWQTETGGHMITPLPGTPAKPGS
ASLPFHGVDPRLLDAEGRELDGAAEGNLVIAASWPGQMRGLWGDPARFFDAYFSLYPGVY
TTGDGARRDADGYWWITGRVDDVINVSGHRMGTAEVESALVLHADVAEAAVVGFPHDVKG
QGIYAYVTLNAGVAADETLRAALRDWVRREIGPIATPDAIQFAPGLPKTRSGKIMRRILR
KIAEGDTASLGDTSTLADPGVVKALLSESQARVPG
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgccaccccgctcgccgaccgtcaggccgtccacgcccgttcgctcgccgat
cccgatggcttctggctggaggcggcgacccggctcgactggatgacggcgccgtcgcgc
gcgggcgactggtcgttcgatcgcgacgatttccatatccgctggttcgaggacggcgtg
ctcaacgtcgccgccaattgcatcgaccgccatctcgccacgcgcggcgatcaggtcgcg
atcctgtgggagggcgacgatcccaccaccgcgccgcgccacatcacttatgccgaactg
caccgtgaggtgtcgcgcttcgccaacgtgctcaaagggctcggcgcggggaagggcgac
cggatcaccctctatatgccgatgatccccgaggcggcgttcgcgatgctcgcctgcgcg
cggatcggcgcggtccattcggtggtgttcgccggcttttccgccgaggcgctcgccggc
cggatcgccgattgcgacagccggatcgtcatcaccgccgaccagggccgccgcggcggc
cgcacgatcgcgctcaaggcttgcgtcgacgaggcgctggcgatcgcgcgcgccgtcgac
cacgtcctcgtcgtccgcgcgaccggcgccgaggtgccgatgaccgcgggccgcgacatc
tggtatcacgaggccgcgctgaacgtcgccgccgactgcccgcccgagccgatggcggcg
gaggaccccttgttcatcctctacaccagcggttcgaccggcaagcccaagggcgtcgtc
cacagcaccggcggctatctgctgtgggcggcgatgacgcacgcgacggtgttcgattac
accgcgcccgacgtctattggtgcgccgccgatatcggctgggtcaccggccacagctat
atcgtctacggcccgctcgccaatggcgcgacgacgctgatgtacgagggcgttcccaac
tggccgaccccggcgcggatatgggaggtggtcgaccggcatcgcgtgacgacgctctat
accgcgccgaccgcgctgcgcgcgctgatgaaggagggggacgcttatgtcaccggcacc
agccgcgcctcgctcaagctgctgggatcggtcggcgagccgatcaatcccgaggcatgg
cgctggtatcacgacgtcgtcggcggcggccgctgtccggtgatggacacctggtggcag
accgagaccggcggccatatgatcacgccgctgcccggcacgccggccaagcccggctcg
gcgagcctgcccttccacggcgtcgatccgcgcctgctcgatgccgagggccgcgaactg
gatggcgcggcggagggcaatctggtcatcgccgcttcctggcccgggcagatgcgcggc
ctgtggggcgatcccgcgcgcttcttcgacgcctatttcagcctctatccgggcgtctac
accaccggcgatggcgcgcgacgcgacgcggacggctattggtggatcaccggccgcgtc
gacgacgtgatcaacgtcagcggtcatcgcatgggcaccgccgaggtggagagcgcgctc
gtcctccacgccgatgtcgccgaggcggcggtggtcggctttccgcacgacgtgaagggg
caggggatctatgcctatgtcacgctgaacgccggcgtcgccgccgacgagacgctgcgc
gcggccttgcgcgactgggtgcggcgcgagatcggcccgatcgcgacccccgacgcgatc
cagttcgcccccggcctgcccaagacccgctcgggcaagatcatgcgccgcatcctgcgc
aagatcgccgagggggatacggcaagcctcggcgatacttcgacgctcgctgatcccggc
gtggtgaaggccctcctctccgaatcgcaggccagagtgcccggctag

DBGET integrated database retrieval system