KEGG   Sphingomonas taxi: MC45_03545Help
Entry
MC45_03545        CDS       T03398                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
stax  Sphingomonas taxi
Pathway
stax00020  Citrate cycle (TCA cycle)
stax00190  Oxidative phosphorylation
stax00650  Butanoate metabolism
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01130  Biosynthesis of antibiotics
stax01200  Carbon metabolism
Module
stax_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC45_03545
   00650 Butanoate metabolism
    MC45_03545
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MC45_03545
Enzymes [BR:stax01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MC45_03545
    1.3.5.4  fumarate reductase (quinol)
     MC45_03545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 CCER1 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AIT05628
UniProt: A0A097EDH4
LinkDB All DBs
Position
complement(813085..813870)
Genome map
AA seq 261 aa AA seqDB search
MAEFTLPKNSKVKAKGKVHKATGDAQRIKTFKVYRYDPDTAENPRYDTFEINLDECGPMV
LDALIKMKAEQDSSLTFRRSCREGICGSCSMNIDGRNGLACTTAIEDVKGEVKITPLPAM
DVIKDLVPDFTHFYAQYSSIKPWMQTVSPPPSGKERLQSPEDRAKLDGLYECILCACCST
SCPSYWWNADKFLGPAILLQAYRWLADSRDEMTGERLDQLEDPFRLYRCHTIMNCANTCP
KGLNPAKAIAEIKKMEAERIL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcaccctgcccaagaacagcaaggtcaaggcgaagggcaaggttcataaa
gcgaccggtgacgcgcagcgcatcaagaccttcaaggtctatcgctacgatcccgatacc
gccgagaacccgcgttacgatacgttcgagatcaacctcgacgaatgcggcccgatggtg
ctcgacgcgctcatcaagatgaaggccgagcaggattcgtcgctcaccttccgccggtcg
tgccgcgagggcatttgcgggtcctgctcgatgaacatcgacggccgcaacggcctcgcc
tgcaccaccgcgatcgaggacgtgaagggcgaggtgaagatcaccccgctgccggcgatg
gacgtcatcaaggacctcgtccccgacttcacgcatttctatgcgcaatacagctcgatc
aagccgtggatgcagacggtcagtccgccaccctcgggcaaggagcggctgcagtcgccc
gaggatcgcgccaagctcgacggtctctacgagtgcatcctgtgcgcctgctgctcgacc
tcgtgcccgagctattggtggaacgccgacaagttcctcgggccggcgatcctgctccag
gcctatcgctggctcgccgacagccgcgacgagatgaccggcgagcggctcgaccagctc
gaggatccgttccgcctctatcgctgccacacgatcatgaattgcgcgaacacctgcccc
aagggtctcaacccggccaaggcgatcgccgagatcaagaagatggaagccgagcgcatc
ctgtaa

DBGET integrated database retrieval system