KEGG   Sphingomonas taxi: MC45_09775Help
Entry
MC45_09775        CDS       T03398                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
stax  Sphingomonas taxi
Pathway
stax00071  Fatty acid degradation
stax00280  Valine, leucine and isoleucine degradation
stax00281  Geraniol degradation
stax00310  Lysine degradation
stax00360  Phenylalanine metabolism
stax00362  Benzoate degradation
stax00380  Tryptophan metabolism
stax00410  beta-Alanine metabolism
stax00627  Aminobenzoate degradation
stax00640  Propanoate metabolism
stax00650  Butanoate metabolism
stax00903  Limonene and pinene degradation
stax00930  Caprolactam degradation
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01130  Biosynthesis of antibiotics
stax01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MC45_09775
   00650 Butanoate metabolism
    MC45_09775
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC45_09775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC45_09775
   00310 Lysine degradation
    MC45_09775
   00360 Phenylalanine metabolism
    MC45_09775
   00380 Tryptophan metabolism
    MC45_09775
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MC45_09775
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MC45_09775
   00281 Geraniol degradation
    MC45_09775
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC45_09775
   00627 Aminobenzoate degradation
    MC45_09775
   00930 Caprolactam degradation
    MC45_09775
Enzymes [BR:stax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MC45_09775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 DRIM
Motif
Other DBs
NCBI-ProteinID: AIT06611
UniProt: A0A097EGD0
LinkDB All DBs
Position
complement(2163673..2164716)
Genome map
AA seq 347 aa AA seqDB search
MSDDLLIQTEGAVGRLRLNRPKALHALNRAMCDGMLAALEAWRSDADVAAVLLDHAEGRG
FCAGGDIRMLSESGATDGAAARGFFLSEYRLNHRLFTYAKPTVSVMDGVTMGGGVGIALP
CRYRIATENTRFAMPETGIGLFPDVGGGWYLARLPGRIGQFLALTGHRLDGAEAHALGLA
THYLPAAAVEAAKAAIVADPRDIDGALDRLAVTPPAAKLLSHRDEIDRLFASDTLEDVLA
TLEADDGAFAAEQLAILRTKSPQAMKVSLRLLYDGGLMQSFADEMVQEYAVACRVVQRHD
FLEGVRAVIVDKDQTPRWQPPTAEDVTDHVIDQIFAPMPEGEAWTPA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgacctgctgatccagacagagggtgccgtcggccggctgcgcctcaaccgt
cccaaggcgctgcatgcgctcaaccgcgccatgtgcgacggcatgctcgccgcgctggag
gcgtggcggagcgacgccgacgtcgccgcggtgctgctcgaccatgccgaggggcgcggc
ttctgtgccgggggcgacatccgcatgctgagcgagagcggcgcgaccgacggcgcggcg
gcgcgcggtttcttcctcagcgaataccggctcaaccaccggctcttcacctatgccaag
ccgacggtgtcggtgatggatggggtgacgatgggcggcggtgtcggcatcgccttgccc
tgccgctaccgcatcgccaccgagaatacgcgattcgcgatgccggagacggggatcggc
ctgttccccgatgtcggtggcggctggtatctggcgcggctgccgggacggatcggtcag
ttcctcgcgcttaccggccatcgcctcgacggcgccgaggcgcatgcgctggggctcgcg
acgcattatctgcctgccgccgcggtggaagccgccaaggcggcgatcgtcgccgatccg
cgcgatatcgacggtgcgctcgatcggctcgccgtgacgccgccggccgccaagctgctg
tcgcaccgcgacgagatcgaccggctgttcgcctccgacacgctggaggacgtgctggcg
acgcttgaagccgacgacggcgcctttgccgccgaacagctcgccatcctgcggaccaag
tcgccgcaggcgatgaaggtgtcgctgcggctgctctacgacggcgggctgatgcagagc
ttcgccgacgagatggtgcaggaatatgccgtcgcctgccgcgtcgtgcagcgccacgac
ttcctcgaaggggtgcgcgcggtgatcgtcgacaaggaccagacgccgcgctggcagccg
ccgaccgccgaagacgtcaccgaccacgtcatcgaccagattttcgcgccgatgcccgag
ggcgaggcgtggacgcccgcataa

DBGET integrated database retrieval system