KEGG   Sphingomonas taxi: MC45_10885Help
Entry
MC45_10885        CDS       T03398                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
stax  Sphingomonas taxi
Pathway
stax00620  Pyruvate metabolism
stax01100  Metabolic pathways
stax01120  Microbial metabolism in diverse environments
stax01200  Carbon metabolism
Module
stax_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC45_10885
Enzymes [BR:stax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     MC45_10885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Hydrolase
Motif
Other DBs
NCBI-ProteinID: AIT06792
UniProt: A0A097EGV0
LinkDB All DBs
Position
complement(2395213..2397471)
Genome map
AA seq 752 aa AA seqDB search
MSDEASVQFSEREALLFHSEGRPGKIEIIASKPMATQRDLALAYSPGVAVPVQAIADDPA
MAYDYTAKGNLVAVISNGTAILGMGNLGALASKPVMEGKAVLFKRFADVDSIDIELKTED
VNRFIDAVELMEPTFGGINLEDIKAPECFIIEQTLRERMNIPVFHDDQHGTAIIASAGLI
NACLLTGRRLSDVKLVVNGAGAAAIACTELMKAMGVRHDNVIMCDKTGVIYQGRDDVNQW
QSAHAANTTKRTLTEALEGADVFLGLSAAGALKPEMVEHMAPSPIIFAMANPEPEIRPEL
AKAARPDAIVATGRSDYPNQVNNVICFPFIFRGALDVRATGINDAMKIAAANAIAELARQ
RVPEEVAVAYGVQHSFGPEYIIPSPFDPRLMELVPSAVAKAAMDSGVAIKPILDMDAYRQ
TLRARLNPTTSVLSLAYEGARARPKRVLFAEGEEEVVLRAAISFKEGGYGTPVLVGRDDV
YDRLKALGVANPQEYEVHNSRHSPLVPKMVDFVYSRLQRRGYLRRDVERMINQDRNVFGA
ALLQLGEADVMITGITRTWAESMRQVKRVIDPEAGRTPFGIHVLVGQSHTVFIADTTVNE
RPTGEQLADFAEQTAQVARRMGHEPRVAMLSYSTFGNPKGAWVDNIREAVSVLDGRNVGF
EYEGEMPPDVALNPRQLANYPFARLSGPANILIMPGLQSAHISAKLLRELGGDSVIGPML
IGMEKPVQIAPMTSTASELVTLAVLAAGGIAR
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaagcgtccgtccaattctccgagcgcgaggcgctcctgttccattccgag
ggacggcccggcaagatcgagatcatcgcgtccaagccgatggcgacgcagcgcgacctc
gcgctcgcctattcgcccggcgtcgcggtgccggtgcaggcgatcgccgacgatccggcg
atggcctatgactataccgccaagggcaatctggtcgccgtcatctcgaacggcaccgcg
atcctcggcatgggcaatctcggcgcgctcgcgtccaagccggtgatggagggcaaggcg
gtgctcttcaagcgcttcgccgacgtcgattcgatcgacatcgaattgaagaccgaggac
gtcaaccgcttcatcgacgcggtcgagctgatggagccgaccttcggcggcatcaacctc
gaggatatcaaggcgcccgaatgtttcatcatcgagcagacgctgcgcgagcggatgaac
atcccggtcttccatgacgaccagcacggcaccgcgatcatcgcctcggcggggctcatc
aacgcctgcctgctcaccggccgccgcctgtcggacgtcaagctcgtcgtcaacggcgcg
ggcgcggcggcgatcgcctgcaccgagctgatgaaggcgatgggcgtgcgccacgacaac
gtcatcatgtgcgacaagaccggcgtcatctatcagggtcgcgacgacgtgaaccagtgg
cagtcggcgcatgccgccaacaccaccaagcgcacgctgaccgaggcgctggagggcgcg
gacgtgttcctcggcctgtccgccgcgggcgcgctcaagcccgagatggtcgagcatatg
gcgccgtcgccgatcatcttcgcgatggccaatcccgagcccgagatccgccccgagctc
gccaaggcggcgcgccccgatgcgatcgtcgccaccggccggtcggactatccgaaccag
gtcaacaatgtgatctgcttccccttcatcttccgcggcgcgctcgacgtgcgggccacc
ggcatcaacgatgcgatgaagatcgccgccgccaatgcgatcgccgagctcgcccgccag
cgcgtgcccgaggaagtggcggtcgcctatggcgtgcagcacagcttcggccccgaatat
atcatcccgtcgccgttcgatccgcggctgatggagctggtgccgtcggcggtggccaag
gcggcgatggattcgggggtggcgatcaagccgatcctcgacatggacgcctatcgccag
acgctgcgcgcgcggctcaacccgaccacttcggtgctcagcctcgcttatgagggcgcg
cgggcgcggccgaagcgcgtgctgttcgccgagggcgaggaagaggtagtgctgcgcgcc
gccatctcgttcaaggaaggcggctatggcacgccggtgctggtcggccgcgacgacgtc
tacgaccggttgaaggcgctcggcgtcgccaatccgcaggagtatgaggtccacaacagc
cggcattcgccgctcgtcccgaagatggtcgatttcgtttacagccggctgcagcgccgc
ggctatctgcgccgcgacgtcgagcggatgatcaaccaggatcgcaacgtcttcggtgcg
gccttgctgcaactgggcgaggcagacgtgatgatcaccggcatcacccgcacttgggcc
gaatcgatgcggcaggtgaagcgcgtgatcgatcccgaggcgggccgcaccccgttcggc
atccacgtcctcgtcggccagagccacaccgtcttcatcgctgacacgacggtgaacgaa
cggccgaccggcgaacagctcgccgatttcgccgaacagaccgcgcaggtcgcgcgccgc
atgggccacgaaccgcgcgtcgcgatgctgagttattcgaccttcggcaacccgaagggc
gcgtgggtcgacaatatccgcgaggcggtgtcggtgctcgacgggcgcaacgtcggcttc
gaatatgaaggcgagatgccgcccgacgtcgcgctcaacccgcgccagctcgccaattat
ccgttcgcgcgcctctcgggtccggcgaacatcctcatcatgcccggcctgcaatcggcg
catatctccgccaaattgctgcgcgaactgggtggcgacagcgtcatcgggccgatgctg
atcggcatggagaagccggtacagatcgcaccgatgacctcgaccgcgagcgagctggtg
acgctggcggtgctcgccgctggcggcatcgcgcggtaa

DBGET integrated database retrieval system